bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6583_orf3 Length=60 Score E Sequences producing significant alignments: (Bits) Value 5518.FG09991.1 64.7 7e-10 > 5518.FG09991.1 Length=717 Score = 64.7 bits (156), Expect = 7e-10, Method: Composition-based stats. Identities = 33/68 (48%), Positives = 42/68 (61%), Gaps = 9/68 (13%) Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEE---------KQKIT 51 YDQL L +M+ +TA TP +G VA TD RW+ IS +VD R PEE ++I Sbjct 291 YDQLSPLGPIMLALTAATPVYKGFVANTDVRWNQISRAVDCRTPEELGEKPLTEGVRRIP 350 Query 52 KSRYSSNS 59 KSRY+SNS Sbjct 351 KSRYASNS 358 Lambda K H 0.318 0.128 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22504648851 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40