bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6590_orf1 Length=119 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL7P1.162 145 2e-34 > 5833.MAL7P1.162 Length=4971 Score = 145 bits (367), Expect = 2e-34, Method: Composition-based stats. Identities = 61/128 (47%), Positives = 91/128 (71%), Gaps = 9/128 (7%) Query 1 IAQFITKWMILSILWGMGGSLSLAARSAFSEEVARFCDLPLPSQLAS---------SDAD 51 I ++I+KW+++SILWG+GGSL+L R FS V C +PLP+ L S ++ Sbjct 2651 IEKYISKWLVVSILWGIGGSLNLETREKFSMFVQSICSIPLPNDLLSKGKMPNMDNTNKI 2710 Query 52 GQTLLDFEPSIDDGQWHHWKSRVKQVEIDTQQVKDATLVIQTVDTLRHRDVVEGWLEEKR 111 TLLD++P+I+DG+W +WK V+ +++D ++ DATLVI+T+DT+RH ++EGWL K+ Sbjct 2711 SNTLLDYQPNIEDGEWINWKELVQIIDVDRTEISDATLVIETMDTIRHETILEGWLHLKK 2770 Query 112 PFILCGPP 119 PFILCGPP Sbjct 2771 PFILCGPP 2778 Lambda K H 0.321 0.136 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22381075488 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40