bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6627_orf2 Length=141 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL8P1.146 95.1 5e-19 > 5833.MAL8P1.146 Length=728 Score = 95.1 bits (235), Expect = 5e-19, Method: Composition-based stats. Identities = 58/139 (41%), Positives = 88/139 (63%), Gaps = 0/139 (0%) Query 3 GVDALNERISLVEKEFIIERDKQNRDSEDKHSQINADLAALQHAFETDKSSRQERELQLA 62 + LNE+I+ + E+ K + E K++ I + A LQ F+ +K +E+E + Sbjct 573 AIKVLNEKINNISSNIENEKVKCIQSLEKKNNNIAKEFATLQSNFQQEKIHNKEKENNIC 632 Query 63 KRLGDLEYRTEGKFEAEKNAREQKIEQLREELEEAKRIRERGEEKFQTFILEEVAALKNG 122 K+L ++E + E K + EKN R+ K +++ +EE KR ++ E FQ F+LEE+A +KNG Sbjct 633 KKLEEIEKKNEAKIDTEKNIRDSKYQEIISYIEEIKREKKGKNENFQNFVLEEIATIKNG 692 Query 123 LILESQAREGADDDIVQAV 141 LI+ESQARE ADDDIVQAV Sbjct 693 LIMESQAREAADDDIVQAV 711 Lambda K H 0.311 0.129 0.332 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22827922775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40