bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6637_orf1 Length=121 Score E Sequences producing significant alignments: (Bits) Value 7719.ENSCINP00000010387 97.8 9e-20 > 7719.ENSCINP00000010387 Length=1398 Score = 97.8 bits (242), Expect = 9e-20, Method: Compositional matrix adjust. Identities = 47/99 (47%), Positives = 62/99 (62%), Gaps = 1/99 (1%) Query 16 SADGGSCKDVDECAAGTAECHVSAQCVNVDGSYECHCLEGFIGDGKVCSDVDECAAEASP 75 + DG +C D+DECA GT CH +A C N GS+ C C GF GDG C+D+DEC Sbjct 490 TGDGVTCTDIDECALGTHSCHTNANCTNTLGSFTCTCKTGFTGDGVSCTDIDECTLGTHN 549 Query 76 CGANTHCLNTIGSYECECKDGYGHMEGYACSDIDQCSQA 114 C N +C NTIGS+ C CK G+ +G +C+DID+C+ Sbjct 550 CHTNANCTNTIGSFTCTCKTGF-TGDGVSCTDIDECTMG 587 Lambda K H 0.318 0.133 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22998535989 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40