bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6662_orf1 Length=150 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0250 75.1 6e-13 > 5833.PF14_0250 Length=1320 Score = 75.1 bits (183), Expect = 6e-13, Method: Composition-based stats. Identities = 47/147 (31%), Positives = 79/147 (53%), Gaps = 9/147 (6%) Query 1 GRLHYGLTYLLDKAVRP----LVEQELNRLEERI-VGGETPVVIVFSGHSLGAVMAQLSA 55 GRLH G ++ ++ V+P L + LN L+ + ETP I+F+GHS GA +AQ+S+ Sbjct 1056 GRLHKGYLFMFEQTVKPYLDGLKKVLLNELKNKSKYTSETPYAIIFTGHSFGAALAQISS 1115 Query 56 WYLAKRAKTLVDKKLLQIRTVAVGCPSWGDKLAYEDMAASGVNAQEINIDIDPVGVLF-- 113 +Y +K L ++ L++ ++ G P++ D YED SGV INI+ DPV V+ Sbjct 1116 FYFSK-IMDLKNRTNLKLYSITFGLPTYQDSTFYEDFRNSGVIINNININHDPVRVIMAV 1174 Query 114 -GETELTKLSHRKPFLMKLYIEDMDKV 139 G + + ++ +E + K+ Sbjct 1175 PGINDFVNHDEERKLMINFEVEQLKKL 1201 Lambda K H 0.318 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22764965652 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40