bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6698_orf1 Length=182 Score E Sequences producing significant alignments: (Bits) Value 7165.AGAP001519-PA 287 1e-76 > 7165.AGAP001519-PA Length=2146 Score = 287 bits (734), Expect = 1e-76, Method: Compositional matrix adjust. Identities = 138/181 (76%), Positives = 154/181 (85%), Gaps = 0/181 (0%) Query 1 ECAGKNQVLIFVHSRKEAVKTAKFICDAALQKDTLPRFLQSFSASREILQAEAEAVKTQD 60 E AG+NQVL+FVHSRKE KTA+ I D L+KDTL FL+ SAS E+L++EAE VK Q+ Sbjct 716 EHAGRNQVLVFVHSRKETGKTARAIRDMCLEKDTLGTFLRDGSASMEVLRSEAEQVKNQE 775 Query 61 LKDLLPYGFAVHHAGLPRTDRKLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQV 120 LKDLLPYGFA+HHAG+ R DR LVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQV Sbjct 776 LKDLLPYGFAIHHAGMTRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQV 835 Query 121 YLPEKGAWSELSPMDILQMMGRAGRPQYDTGGHAILITQHSELQFYLSLNNQQLPIESQM 180 Y PEKG W EL +D+LQM+GRAGRPQYDT G ILIT HSELQ+YLSL NQQLPIESQ+ Sbjct 836 YNPEKGRWVELGALDVLQMLGRAGRPQYDTKGEGILITNHSELQYYLSLLNQQLPIESQL 895 Query 181 I 181 I Sbjct 896 I 896 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 38282551062 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40