bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6747_orf2 Length=124 Score E Sequences producing significant alignments: (Bits) Value 5833.PF10_0219 132 4e-30 > 5833.PF10_0219 Length=891 Score = 132 bits (331), Expect = 4e-30, Method: Composition-based stats. Identities = 61/126 (48%), Positives = 83/126 (65%), Gaps = 3/126 (2%) Query 2 VQCEQPSPRAHASLTLVPSGDFLLFGGESFDGKKVRVFGDLFKWDMDKAEWKR-LEAPEM 60 V+CE+PSPR++ S+T + +F+LFGGE D ++ + DLFK+++ K +WK + Sbjct 72 VECEKPSPRSNCSITFINDEEFILFGGEYNDNNELISYNDLFKYNIVKNKWKYYFTTSKK 131 Query 61 PKARCSHQAVYHNDALYIFGGEFSTYYQFHHFKDFWKFDLKTNLWSKILVESST--QVPS 118 PK RCSHQ VY N LYIFGGE T QF H+ DFW FDLK N++ +I ++ PS Sbjct 132 PKPRCSHQTVYFNKKLYIFGGELCTNTQFFHYNDFWSFDLKNNVFEEIETKNKKDDNKPS 191 Query 119 PRSGHR 124 PRSGHR Sbjct 192 PRSGHR 197 Lambda K H 0.322 0.137 0.449 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22752691665 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40