bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6765_orf1 Length=177 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd5_2070 135 6e-31 > 5807.cgd5_2070 Length=2123 Score = 135 bits (340), Expect = 6e-31, Method: Compositional matrix adjust. Identities = 70/163 (42%), Positives = 106/163 (65%), Gaps = 9/163 (5%) Query 9 ERIIQMLPCPFLAMSATVGNPDSFVGWLRRCA--PRGDVRLVCHKERFSDLHMHLYLQDK 66 ERI Q++PCP+L +SAT+GNP +F WL+R P V V + ER++DL +Y + Sbjct 1198 ERIFQLIPCPYLCLSATIGNPLAFYNWLQRIGKLPSSKVHFVTYSERYADLSTLVYDEGN 1257 Query 67 VLPFNPVAALHFNKVLGEGLAEDFYLPPVDSLNLYLALSRILK-----TSNLFSFLFNPS 121 + P NP+++L +++VL GL DFYLPP D L+L+L+L +LK T ++L +P Sbjct 1258 LYPLNPLSSLSYDRVLYYGLPGDFYLPPNDGLDLFLSLKELLKCNSEATKEYLAWL-DPQ 1316 Query 122 FYFQGTPAITKKQYSFYWQTMRAHFVYMVRESKEIDLEAFLNL 164 F+F GTPAITK+QY FY T+ A V +V ++ ++ E +LN+ Sbjct 1317 FFFSGTPAITKRQYRFYLSTLLAITVKLV-QNNVLNKEMWLNI 1358 Lambda K H 0.325 0.139 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35195248557 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40