bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7015_orf1 Length=87 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd6_4610 75.1 6e-13 > 5807.cgd6_4610 Length=333 Score = 75.1 bits (183), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 29/83 (34%), Positives = 52/83 (62%), Gaps = 2/83 (2%) Query 5 FTETAPILSCCFGDTTQMLLTAGCDKQVKAYDLISGRTTGQVIGQHDSPVNFVAWNPMYK 64 F +AP+L C ++ L + GCD ++K +D+ S ++ Q IG+HD+P++ + W K Sbjct 54 FQHSAPVLDCAISSDSRYLFSGGCDNELKMHDMSSRQS--QTIGRHDAPISNIFWCDEQK 111 Query 65 LVISTSWDGAVKMWDGKQPNPVW 87 V++ SWD +K W+G+ NP++ Sbjct 112 FVVTGSWDKTIKFWNGQSQNPIY 134 Lambda K H 0.319 0.133 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22371284777 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40