bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7790_orf1 Length=64 Score E Sequences producing significant alignments: (Bits) Value 69293.ENSGACP00000019814 71.2 8e-12 > 69293.ENSGACP00000019814 Length=400 Score = 71.2 bits (173), Expect = 8e-12, Method: Compositional matrix adjust. Identities = 31/62 (50%), Positives = 44/62 (70%), Gaps = 0/62 (0%) Query 3 FIRNYEVPGRPVLLCGWMEDWPAMRRWDIESLRRAYRTAKFKVGEKDNGDKIKLKIKYFI 62 FIR +E P RPV+L G E WPA +W +E L+R YR KFK GE ++G +K+K+KY++ Sbjct 59 FIRRFERPYRPVVLQGCQEAWPAREKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYM 118 Query 63 DY 64 +Y Sbjct 119 EY 120 Lambda K H 0.325 0.143 0.475 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23129559180 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40