bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_8568_orf1 Length=83 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd1_580 95.1 5e-19 > 5807.cgd1_580 Length=752 Score = 95.1 bits (235), Expect = 5e-19, Method: Composition-based stats. Identities = 44/83 (53%), Positives = 62/83 (74%), Gaps = 2/83 (2%) Query 3 DKRLQKYFDQ--DQCLTIGSCIRHEYTSLLEEYCERNISEDITDSQIENAIRLHEGESLP 60 DKRLQ YFD D ++ G+ IR + LL+EY E +++ ++TD I+ AIR+HEG+S+P Sbjct 288 DKRLQTYFDHGSDGGMSSGAQIRVIFNELLDEYTENDVTSELTDYDIDAAIRMHEGDSMP 347 Query 61 GFPSPDTFEHLILPYLKKLSPPV 83 GFPSPD FE+LILP+L+K+ PV Sbjct 348 GFPSPDMFEYLILPHLRKIQAPV 370 Lambda K H 0.317 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22659344793 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40