bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0003_orf1 Length=254 Score E Sequences producing significant alignments: (Bits) Value 7295431 34.3 0.26 YDR412w 33.1 0.58 Hs20543401 31.6 1.6 Hs13236553 30.4 3.9 SPAC29A4.09 30.0 5.1 Hs4504797_1 29.3 8.8 > 7295431 Length=770 Score = 34.3 bits (77), Expect = 0.26, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 4/52 (7%) Query 26 KLEFVTGVSKRKEQRRNEAKIRAIERQKEERRRLRAERREKIREHITHVRHS 77 ++EF++G KRK +RR+ AK K ER+R+R E +++ H++ S Sbjct 550 RIEFLSGFRKRKNERRSRAKADLERNLKNERKRIRQE----VKDGFNHLKKS 597 > YDR412w Length=235 Score = 33.1 bits (74), Expect = 0.58, Method: Compositional matrix adjust. Identities = 21/59 (35%), Positives = 38/59 (64%), Gaps = 4/59 (6%) Query 23 RSCKLEFVTGVSKRKEQRRNEAK--IRAIERQK--EERRRLRAERREKIREHITHVRHS 77 + +L+++TG KRK QR+ +A+ I+ ER + EER+++R ER+E + E + + S Sbjct 33 KDSRLDYLTGFHKRKLQRQKKAQEFIKEQERLRKIEERQKIRQERKEVMEEQLKTFKES 91 > Hs20543401 Length=2092 Score = 31.6 bits (70), Expect = 1.6, Method: Compositional matrix adjust. Identities = 26/87 (29%), Positives = 37/87 (42%), Gaps = 6/87 (6%) Query 97 VSQTKGSSSSSKRHRNAAGSATSCYVSVGVENNAEAQLSQDHAVEPMQNVRLLPPSA--- 153 +S + S + S RH+ ++G +S E + A D EP + LPP Sbjct 425 LSTSNSSDTESNRHKLSSGLLPKLAISTEGEQDEAASCPGDPHEEPGKPA--LPPEECAQ 482 Query 154 -EEAAASPWQIASCVSLSVGGFMEHLK 179 E +P S +LSVG F EHL Sbjct 483 EEPEVTTPASTISSSTLSVGSFSEHLD 509 > Hs13236553 Length=213 Score = 30.4 bits (67), Expect = 3.9, Method: Compositional matrix adjust. Identities = 17/36 (47%), Positives = 24/36 (66%), Gaps = 0/36 (0%) Query 28 EFVTGVSKRKEQRRNEAKIRAIERQKEERRRLRAER 63 E++TG KRK +R+ A +R KEE+R+LR ER Sbjct 29 EYLTGFHKRKVERKKAAIEEIKQRLKEEQRKLREER 64 > SPAC29A4.09 Length=203 Score = 30.0 bits (66), Expect = 5.1, Method: Compositional matrix adjust. Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 0/52 (0%) Query 14 QTLEVSAAQRSCKLEFVTGVSKRKEQRRNEAKIRAIERQKEERRRLRAERRE 65 Q LE + + E++TG KRK +RR A+++ ++++EER LR RE Sbjct 22 QRLEEIVFDKEKRKEYLTGFHKRKVERRKHAQVQLEQQKREERLALRKSLRE 73 > Hs4504797_1 Length=1221 Score = 29.3 bits (64), Expect = 8.8, Method: Compositional matrix adjust. Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 0/38 (0%) Query 34 SKRKEQRRNEAKIRAIERQKEERRRLRAERREKIREHI 71 ++R +Q+ E KI +E+QKEE +R ER ++ EH+ Sbjct 627 AERLKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHV 664 Lambda K H 0.310 0.121 0.329 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 5258582968 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40