bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0213_orf3 Length=190 Score E Sequences producing significant alignments: (Bits) Value At2g03820 32.3 0.61 YHR170w 31.6 1.0 SPAC16C9.03 30.4 2.2 Hs14165274 28.5 7.8 > At2g03820 Length=516 Score = 32.3 bits (72), Expect = 0.61, Method: Compositional matrix adjust. Identities = 13/26 (50%), Positives = 20/26 (76%), Gaps = 0/26 (0%) Query 46 DEDMEEFRKDLEDDAELRKQVLLYKD 71 D++ EEF +DLE++ ELR + LY+D Sbjct 444 DKEYEEFLRDLEENPELRFNISLYRD 469 > YHR170w Length=518 Score = 31.6 bits (70), Expect = 1.0, Method: Compositional matrix adjust. Identities = 14/26 (53%), Positives = 21/26 (80%), Gaps = 0/26 (0%) Query 46 DEDMEEFRKDLEDDAELRKQVLLYKD 71 ++D E F ++LE+DAELR+ V LYK+ Sbjct 443 EKDYELFLQELEEDAELRQSVNLYKN 468 > SPAC16C9.03 Length=498 Score = 30.4 bits (67), Expect = 2.2, Method: Compositional matrix adjust. Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 4/39 (10%) Query 45 EDEDMEEFRKDLEDDAELRKQVLLYKDPRISYTKATGAA 83 ++ D E F ++LE+D ELR+ V LYK P KA A Sbjct 433 QERDYELFLQNLEEDPELRQGVNLYKAP----VKAIAVA 467 > Hs14165274 Length=718 Score = 28.5 bits (62), Expect = 7.8, Method: Compositional matrix adjust. Identities = 18/70 (25%), Positives = 37/70 (52%), Gaps = 0/70 (0%) Query 49 MEEFRKDLEDDAELRKQVLLYKDPRISYTKATGAAKIRVGSSSTSSKQQQGLKRREANKA 108 +E ++K LED +LR+QV L ++ Y + T + + + ++ + Q + KR+ Sbjct 320 VESYKKKLEDLGDLRRQVKLLEEKNTMYMQNTVSLEEELRKANAARSQLETYKRQVVELQ 379 Query 109 RKLAEAHDRA 118 +L+E +A Sbjct 380 NRLSEESKKA 389 Lambda K H 0.305 0.126 0.340 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3166472848 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40