bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0261_orf3 Length=58 Score E Sequences producing significant alignments: (Bits) Value At3g13640 85.9 2e-17 Hs20532766 84.0 7e-17 At4g19210 81.3 4e-16 Hs4506559 80.9 5e-16 7295014 79.3 1e-15 YDR091c 78.6 3e-15 CE21713 75.5 2e-14 SPBC14F5.06 69.3 2e-12 ECU11g1580 56.6 1e-08 CE27445 28.9 2.2 CE01108 27.3 6.7 > At3g13640 Length=603 Score = 85.9 bits (211), Expect = 2e-17, Method: Composition-based stats. Identities = 39/53 (73%), Positives = 44/53 (83%), Gaps = 0/53 (0%) Query 5 SPDSLVNGMNRFLRVLQITFRRDPTNFRPRINKLDSCKDKEQKLTGNYFVLDD 57 SP SL++GMN FL L ITFRRDPTNFRPRINKL+S KDKEQK G+Y+ LDD Sbjct 551 SPQSLLSGMNHFLSHLNITFRRDPTNFRPRINKLESIKDKEQKTAGSYYYLDD 603 > Hs20532766 Length=599 Score = 84.0 bits (206), Expect = 7e-17, Method: Composition-based stats. Identities = 37/54 (68%), Positives = 45/54 (83%), Gaps = 0/54 (0%) Query 4 SSPDSLVNGMNRFLRVLQITFRRDPTNFRPRINKLDSCKDKEQKLTGNYFVLDD 57 +SP +L+ GMN+FL L+ITFRRDP N+RPRINKL+S KD EQK +GNYF LDD Sbjct 546 NSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD 599 > At4g19210 Length=600 Score = 81.3 bits (199), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 38/56 (67%), Positives = 45/56 (80%), Gaps = 0/56 (0%) Query 2 TRSSPDSLVNGMNRFLRVLQITFRRDPTNFRPRINKLDSCKDKEQKLTGNYFVLDD 57 T + P SL++GMN FL L ITFRRDPTNFRPRINKL+S KD+EQK G+Y+ LDD Sbjct 545 TANCPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTKDREQKSAGSYYYLDD 600 > Hs4506559 Length=599 Score = 80.9 bits (198), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 37/53 (69%), Positives = 44/53 (83%), Gaps = 0/53 (0%) Query 5 SPDSLVNGMNRFLRVLQITFRRDPTNFRPRINKLDSCKDKEQKLTGNYFVLDD 57 SP +L+ GMN+FL L+ITFRRDP N+RPRINKL+S KD EQK +GNYF LDD Sbjct 547 SPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD 599 > 7295014 Length=611 Score = 79.3 bits (194), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 38/57 (66%), Positives = 44/57 (77%), Gaps = 0/57 (0%) Query 2 TRSSPDSLVNGMNRFLRVLQITFRRDPTNFRPRINKLDSCKDKEQKLTGNYFVLDDS 58 T SP SL+NGMNRFL +L ITFRRDP NFRPRINK +S KD EQK +G +F L+D Sbjct 552 TAFSPQSLLNGMNRFLELLGITFRRDPNNFRPRINKNNSVKDTEQKRSGQFFFLEDE 608 > YDR091c Length=608 Score = 78.6 bits (192), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 36/54 (66%), Positives = 45/54 (83%), Gaps = 0/54 (0%) Query 5 SPDSLVNGMNRFLRVLQITFRRDPTNFRPRINKLDSCKDKEQKLTGNYFVLDDS 58 +P+SL+ G NRFL+ L +TFRRDP +FRPRINKLDS DKEQK +GNYF LD++ Sbjct 553 APESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKSSGNYFFLDNT 606 > CE21713 Length=610 Score = 75.5 bits (184), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 35/56 (62%), Positives = 42/56 (75%), Gaps = 0/56 (0%) Query 2 TRSSPDSLVNGMNRFLRVLQITFRRDPTNFRPRINKLDSCKDKEQKLTGNYFVLDD 57 T P SL+ GMNRFL++L ITFRRD +RPRINKLDS KD +QK +G +F LDD Sbjct 554 TACKPQSLLEGMNRFLKMLDITFRRDQETYRPRINKLDSVKDVDQKKSGQFFFLDD 609 > SPBC14F5.06 Length=593 Score = 69.3 bits (168), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 32/52 (61%), Positives = 38/52 (73%), Gaps = 0/52 (0%) Query 6 PDSLVNGMNRFLRVLQITFRRDPTNFRPRINKLDSCKDKEQKLTGNYFVLDD 57 P SL+ GMN FL+ L +TFRRDP RPRINK DS D+EQK GNYF L++ Sbjct 542 PQSLLTGMNTFLKNLDVTFRRDPNTLRPRINKFDSQMDQEQKNAGNYFFLEN 593 > ECU11g1580 Length=624 Score = 56.6 bits (135), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%) Query 4 SSPDSLVNGMNRFLRVLQITFRRDPTNFRPRINKLDSCKDKEQKLTGNYF 53 S P L++GMN FL+ L +TFRRD +N RPR+NK S KD+ QK YF Sbjct 573 SPPMGLLDGMNIFLKSLDVTFRRDSSNLRPRVNKPGSAKDRIQKENNQYF 622 > CE27445 Length=625 Score = 28.9 bits (63), Expect = 2.2, Method: Compositional matrix adjust. Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Query 10 VNG-MNRFLRVLQITFRRDPTNFRPRINKLDSCKDKEQKLTGNYFVL 55 +NG MN + LQ PTNF P I ++ + K K T Y +L Sbjct 414 INGVMNAYRHALQNVTLYGPTNFSPIIVEVANKAQKMMKTTARYQIL 460 > CE01108 Length=784 Score = 27.3 bits (59), Expect = 6.7, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Query 7 DSLVNGMNRFLRVL--QITFRRDPTNFRPRINKLDSCKDKEQKL 48 D++V G+ + LR+L + RD T + + K+D ++ EQ+L Sbjct 683 DTMVLGLGKNLRLLGFDVYIPRDVTELKEFLRKMDKMEESEQRL 726 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1187999082 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40