bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0894_orf3 Length=125 Score E Sequences producing significant alignments: (Bits) Value Hs20149635 33.5 0.10 Hs10047114 33.5 0.11 At4g15410_1 32.7 0.17 CE20100 32.3 0.21 7304214 31.6 0.40 YBL058w 31.6 0.41 At4g22150 31.2 0.51 7299913 29.3 1.7 SPAC343.09 28.9 2.2 At4g04210 28.5 2.9 Hs22042883 28.1 4.2 Hs16876441 27.7 5.1 At3g06450 26.9 8.5 > Hs20149635 Length=370 Score = 33.5 bits (75), Expect = 0.10, Method: Compositional matrix adjust. Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Query 91 FSLLEGFPPRPLSAARSATLQEAGLLNATLSQKLS 125 F L+ FP + L A S TL+EA LLNA + Q+L+ Sbjct 337 FILMTTFPNKEL-ADESQTLKEANLLNAVIVQRLT 370 > Hs10047114 Length=371 Score = 33.5 bits (75), Expect = 0.11, Method: Compositional matrix adjust. Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Query 91 FSLLEGFPPRPLSAARSATLQEAGLLNATLSQKLS 125 F L+ FP + L A S TL+EA LLNA + Q+L+ Sbjct 338 FILMTTFPNKEL-ADESQTLKEANLLNAVIVQRLT 371 > At4g15410_1 Length=463 Score = 32.7 bits (73), Expect = 0.17, Method: Compositional matrix adjust. Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 8/51 (15%) Query 39 RVRAMAIRSLADLR-----GSGEDSPNENGATNSFSGGERSGLAIQNPSSA 84 R A IR+ ADL G G DS + A ++GG++SG+ +Q+P Sbjct 129 RQHAGNIRTFADLNRSPADGEGSDS---DEANEYYTGGQKSGMMVQDPKKV 176 > CE20100 Length=880 Score = 32.3 bits (72), Expect = 0.21, Method: Composition-based stats. Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 8/85 (9%) Query 7 LEREPPRSSATAGPSAAAAAAAAAGAAAASLLRVRAMAIRSLADLRGSGEDSPNENGATN 66 L +E PR++ + S A+ GA A +R+ A+ +R L D S N G T+ Sbjct 714 LYQEQPRAAESLSNSLRASGVDIDGAGAE--MRINALFLRGLHDESIIHSSSRNYGGTTS 771 Query 67 SFSGGERSGLAIQNPSSAFPAPGGF 91 SF+ A+Q S F P GF Sbjct 772 SFN---MHPTAMQ---SVFAMPDGF 790 > 7304214 Length=407 Score = 31.6 bits (70), Expect = 0.40, Method: Compositional matrix adjust. Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Query 90 GFSLLEGFPPRPLSAARSATLQEAGLLNATLSQKL 124 F L+ FP R LS S T+++AGL NA L Q+L Sbjct 373 NFILVSSFPTRELSDDNS-TIEKAGLKNAALMQRL 406 > YBL058w Length=423 Score = 31.6 bits (70), Expect = 0.41, Method: Compositional matrix adjust. Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 2/38 (5%) Query 47 SLADL-RGSGEDSPNENGATNSFSGGERSGLAIQNPSS 83 S +D+ RG +D +E+ N+F+GGE SGL + +PS Sbjct 128 SFSDMVRGQADDD-DEDQPRNTFAGGETSGLEVTDPSD 164 > At4g22150 Length=302 Score = 31.2 bits (69), Expect = 0.51, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Query 41 RAMAIRSLADL--RGSGEDSPNENGATNSFSGGERSGLAIQNPS 82 R IR+L+DL R + + +G F+GGE+SG+ +Q+P+ Sbjct 15 RTGGIRTLSDLNRRSEPDSDSDSDGPQEYFTGGEKSGMLVQDPT 58 > 7299913 Length=1569 Score = 29.3 bits (64), Expect = 1.7, Method: Compositional matrix adjust. Identities = 33/108 (30%), Positives = 49/108 (45%), Gaps = 5/108 (4%) Query 3 LRGRLEREPPRSSATAGPSAAAAAAAAAGAAAASLLRVR-AMAIRSLADLRGSGEDSPNE 61 LR +L+ PR +AT P A A + ASL + I + + G+G P Sbjct 931 LRRKLDITAPRLNATTNPLALTEGAQFIQSDPASLKSSGGSKPITTRTNQNGTG--PPPS 988 Query 62 NGATNSF--SGGERSGLAIQNPSSAFPAPGGFSLLEGFPPRPLSAARS 107 NG S S + +++PS + P+ G F +GF RPL+ A S Sbjct 989 NGLLKSTPSSTDDMDSALLKSPSDSTPSAGLFGKFDGFTLRPLNDASS 1036 > SPAC343.09 Length=410 Score = 28.9 bits (63), Expect = 2.2, Method: Compositional matrix adjust. Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 0/37 (0%) Query 87 APGGFSLLEGFPPRPLSAARSATLQEAGLLNATLSQK 123 +PG F L FP + L S T++ A L NA+L QK Sbjct 372 SPGNFILSVPFPAKTLEDDPSVTVEAASLKNASLVQK 408 > At4g04210 Length=308 Score = 28.5 bits (62), Expect = 2.9, Method: Compositional matrix adjust. Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Query 45 IRSLADL--RGSGEDSPNENGATNSFSGGERSGLAIQNPSS 83 IR+L+DL R + + +G ++GGE+SG+ +Q+PS Sbjct 18 IRTLSDLNRRSGPDSDSDSDGPQEYYTGGEKSGMLVQDPSK 58 > Hs22042883 Length=268 Score = 28.1 bits (61), Expect = 4.2, Method: Compositional matrix adjust. Identities = 26/79 (32%), Positives = 34/79 (43%), Gaps = 13/79 (16%) Query 23 AAAAAAAAGAAAASLLRVRAMAIRSLADL------------RGSGEDSPNE-NGATNSFS 69 A A + AA +S RV+AMA+R ++ R G P E +GA N S Sbjct 184 TAMALTQSRAACSSEYRVKAMAVRGRPEVQAISLPPPQGTWRLHGRRLPTEADGAQNELS 243 Query 70 GGERSGLAIQNPSSAFPAP 88 G R LA PS +P Sbjct 244 GKPRLHLAKNRPSLKTASP 262 > Hs16876441 Length=599 Score = 27.7 bits (60), Expect = 5.1, Method: Compositional matrix adjust. Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Query 27 AAAAGAAAASLLRVRAMAIRSLADLRGSGEDSPNENGATNSFSGGERSGLAIQNPSSAFP 86 AAA A A L +++ MA+ +L GS + +E NS +GG S S F Sbjct 216 TAAAMAEAMKLQKMKLMAMNTLQG-NGSQNGTESEPDDLNSNTGGSESSWDKDKMQSPFA 274 Query 87 APG 89 APG Sbjct 275 APG 277 > At3g06450 Length=736 Score = 26.9 bits (58), Expect = 8.5, Method: Compositional matrix adjust. Identities = 11/17 (64%), Positives = 13/17 (76%), Gaps = 0/17 (0%) Query 43 MAIRSLADLRGSGEDSP 59 + IRSL+D RG GE SP Sbjct 689 VYIRSLSDFRGGGEISP 705 Lambda K H 0.309 0.125 0.339 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1183965632 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40