bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0986_orf1 Length=118 Score E Sequences producing significant alignments: (Bits) Value Hs22035604 30.8 0.68 Hs22035606 30.4 0.78 Hs22035602 30.4 0.86 HsM4758524 30.4 0.88 7297097 30.4 0.92 7303768 29.6 1.4 7292249 29.6 1.4 CE28273 29.3 1.7 CE25673 29.3 1.8 CE25672 29.3 1.8 Hs10835013 28.1 4.3 YPL195w 27.7 5.2 Hs21264355 27.7 5.3 HsM20127432 27.7 5.4 Hs18548863 26.9 8.6 At3g14270 26.9 9.0 7293238 26.9 9.6 > Hs22035604 Length=1320 Score = 30.8 bits (68), Expect = 0.68, Method: Compositional matrix adjust. Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 0/47 (0%) Query 64 LQDEWAKYVLREILWFIQNLSTEHTVRRQKQFKTVMLGLLFNITIVE 110 L+++W Y+ REIL + +L H + R + + V+L + +V+ Sbjct 125 LKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVD 171 > Hs22035606 Length=1212 Score = 30.4 bits (67), Expect = 0.78, Method: Compositional matrix adjust. Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 0/47 (0%) Query 64 LQDEWAKYVLREILWFIQNLSTEHTVRRQKQFKTVMLGLLFNITIVE 110 L+++W Y+ REIL + +L H + R + + V+L + +V+ Sbjct 125 LKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVD 171 > Hs22035602 Length=1166 Score = 30.4 bits (67), Expect = 0.86, Method: Compositional matrix adjust. Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 0/47 (0%) Query 64 LQDEWAKYVLREILWFIQNLSTEHTVRRQKQFKTVMLGLLFNITIVE 110 L+++W Y+ REIL + +L H + R + + V+L + +V+ Sbjct 125 LKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVD 171 > HsM4758524 Length=1165 Score = 30.4 bits (67), Expect = 0.88, Method: Compositional matrix adjust. Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 0/47 (0%) Query 64 LQDEWAKYVLREILWFIQNLSTEHTVRRQKQFKTVMLGLLFNITIVE 110 L+++W Y+ REIL + +L H + R + + V+L + +V+ Sbjct 125 LKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVD 171 > 7297097 Length=1551 Score = 30.4 bits (67), Expect = 0.92, Method: Compositional matrix adjust. Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Query 58 RFNFPLLQDEWAKYVLREILWFIQNLSTEHT-VRRQKQFK 96 R+ P+L ++A+ V RE+ W + + EH VRR K K Sbjct 902 RYGVPMLS-KFAELVNREMFWVVSEICAEHNIVRRMKIVK 940 > 7303768 Length=1931 Score = 29.6 bits (65), Expect = 1.4, Method: Compositional matrix adjust. Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 15/58 (25%) Query 48 PPSAPLPGPLRFNFPLLQDEWAKY---------VLR------EILWFIQNLSTEHTVR 90 PP P +N P++QD+W++Y + R EI + QN T H +R Sbjct 1430 PPPRPHTTVGHYNHPVVQDDWSRYANDLGYSENIARPFAREVEICYQRQNQRTPHCIR 1487 > 7292249 Length=979 Score = 29.6 bits (65), Expect = 1.4, Method: Compositional matrix adjust. Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 0/47 (0%) Query 64 LQDEWAKYVLREILWFIQNLSTEHTVRRQKQFKTVMLGLLFNITIVE 110 L++EW Y+ REIL + L + + R + + V+L + +V+ Sbjct 132 LKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVD 178 > CE28273 Length=1096 Score = 29.3 bits (64), Expect = 1.7, Method: Compositional matrix adjust. Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 0/47 (0%) Query 64 LQDEWAKYVLREILWFIQNLSTEHTVRRQKQFKTVMLGLLFNITIVE 110 L++EW Y+ REIL + +L + R + + V+L + +V+ Sbjct 123 LKEEWIAYICREILRGLYHLHQSKVIHRDIKGQNVLLTDSAEVKLVD 169 > CE25673 Length=1082 Score = 29.3 bits (64), Expect = 1.8, Method: Compositional matrix adjust. Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 0/47 (0%) Query 64 LQDEWAKYVLREILWFIQNLSTEHTVRRQKQFKTVMLGLLFNITIVE 110 L++EW Y+ REIL + +L + R + + V+L + +V+ Sbjct 123 LKEEWIAYICREILRGLYHLHQSKVIHRDIKGQNVLLTDSAEVKLVD 169 > CE25672 Length=1087 Score = 29.3 bits (64), Expect = 1.8, Method: Compositional matrix adjust. Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 0/47 (0%) Query 64 LQDEWAKYVLREILWFIQNLSTEHTVRRQKQFKTVMLGLLFNITIVE 110 L++EW Y+ REIL + +L + R + + V+L + +V+ Sbjct 123 LKEEWIAYICREILRGLYHLHQSKVIHRDIKGQNVLLTDSAEVKLVD 169 > Hs10835013 Length=530 Score = 28.1 bits (61), Expect = 4.3, Method: Composition-based stats. Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 4/52 (7%) Query 2 AGASGKTGRSAPRVRHRAREALSNARSALTSIFREGRDSHRKIDEVPPSAPL 53 AG + ++G APRVR +ALS + LT + E H I PSAP Sbjct 242 AGKAKRSGGHAPRVRELLLDALSPEQLVLTLL--EAEPPHVLISR--PSAPF 289 > YPL195w Length=932 Score = 27.7 bits (60), Expect = 5.2, Method: Composition-based stats. Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Query 70 KYVLREILWFIQNLSTEHTVRRQKQFKTVMLGLLFNITIVEECSLEGWP 118 K VL+E++ F +NLS T Q++ V+ L ++ +EE EG P Sbjct 575 KMVLKELIEFFENLSYSSTFEVQERSVEVLEFLRLSLEALEE-DTEGLP 622 > Hs21264355 Length=411 Score = 27.7 bits (60), Expect = 5.3, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 0/50 (0%) Query 5 SGKTGRSAPRVRHRAREALSNARSALTSIFREGRDSHRKIDEVPPSAPLP 54 +G+ G S P + +E + + TS G +S+ E PP+ P+P Sbjct 356 NGEEGTSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIP 405 > HsM20127432 Length=411 Score = 27.7 bits (60), Expect = 5.4, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 0/50 (0%) Query 5 SGKTGRSAPRVRHRAREALSNARSALTSIFREGRDSHRKIDEVPPSAPLP 54 +G+ G S P + +E + + TS G +S+ E PP+ P+P Sbjct 356 NGEEGTSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIP 405 > Hs18548863 Length=338 Score = 26.9 bits (58), Expect = 8.6, Method: Compositional matrix adjust. Identities = 23/64 (35%), Positives = 26/64 (40%), Gaps = 7/64 (10%) Query 13 PRVRHRAR--EALSNARSALTSIFREGRDSHRKIDEVPPSAPLPGPLRFNFPLLQDEWAK 70 PRV R S A SA + R GR S + S PLP F Q EWA Sbjct 135 PRVSLRGPLPPCPSGADSAADAPARPGRSSRSPL-----SPPLPAVASFGLRRAQGEWAM 189 Query 71 YVLR 74 +V R Sbjct 190 HVKR 193 > At3g14270 Length=1791 Score = 26.9 bits (58), Expect = 9.0, Method: Compositional matrix adjust. Identities = 17/82 (20%), Positives = 35/82 (42%), Gaps = 5/82 (6%) Query 14 RVRHRAREALSNARSALTSIFREGRDSHRKIDEVPPSAPLPGPLRFNFPLLQDEWAKYVL 73 RV H + +L S TS+ ++G+++ R+ + P N DE+ +Y Sbjct 156 RVHHGSDVSLHGVSSMETSVTKQGKETSRRSSFIATDVEDPSRFALNSIRSDDEYDEYGA 215 Query 74 REILWFIQNLSTEHTVRRQKQF 95 + ++ T H+ R + + Sbjct 216 -----YQTDIETSHSPRANEYY 232 > 7293238 Length=1137 Score = 26.9 bits (58), Expect = 9.6, Method: Compositional matrix adjust. Identities = 12/40 (30%), Positives = 23/40 (57%), Gaps = 0/40 (0%) Query 60 NFPLLQDEWAKYVLREILWFIQNLSTEHTVRRQKQFKTVM 99 +F ++ D ++ YVL +L +Q+L+ + QFK +M Sbjct 313 SFAVILDAYSSYVLGNLLMDLQSLNEHDFLEHLPQFKKLM 352 Lambda K H 0.320 0.135 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1167969826 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40