bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1091_orf1 Length=179 Score E Sequences producing significant alignments: (Bits) Value At4g29410 54.3 1e-07 SPAC1687.06c 53.1 3e-07 At2g19730 53.1 3e-07 Hs13904866 44.7 1e-04 CE06313 38.9 0.005 7292335 37.7 0.011 7292336 36.2 0.036 YNL040w 28.9 5.9 > At4g29410 Length=143 Score = 54.3 bits (129), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/123 (29%), Positives = 62/123 (50%), Gaps = 8/123 (6%) Query 53 AELLWQCVRRTSCFLKKSHG-----IVLTREPLNLTQKNTLRHSGLCHPRPLGLQLVGNN 107 +L+W+ V+R +CFL K G + ++E NL N+ +HSGL + + + +Q G + Sbjct 6 GQLIWEIVKRNNCFLVKQFGRGNAKVQFSKESNNLVNINSYKHSGLANKKTVTIQAAGKD 65 Query 108 AAVKL-SYRPKNPNKARFP-RRALCSKKFPKSHSKTKQLQQLVAQQRPDLVRLAKKRFHK 165 V L + + K NK + +++ K+F + SK Q + RPDL + A R Sbjct 66 QGVVLGTTKTKRQNKPKLSVNKSILKKEFSR-MSKVVANQVVDNYYRPDLKKAALARLSA 124 Query 166 LCK 168 + K Sbjct 125 ISK 127 > SPAC1687.06c Length=134 Score = 53.1 bits (126), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 36/117 (30%), Positives = 59/117 (50%), Gaps = 5/117 (4%) Query 51 ASAELLWQCVRRTSCFLKKS---HGIVLTREPLNLTQKNTLRHSGLCHPRPLGLQLVGNN 107 S +L+WQ +R + FL K GI REP+N++ KN R SGLC+ + +G+Q Sbjct 3 VSNDLIWQVIRDNNRFLVKRPEFGGIQFNREPVNVSGKNAQRFSGLCNDKAVGVQANSPR 62 Query 108 AAVKLS-YRPKNPNK-ARFPRRALCSKKFPKSHSKTKQLQQLVAQQRPDLVRLAKKR 162 V ++ PKN K A+ R+ + + + K+ + R DLV+++ R Sbjct 63 GVVLITKTNPKNAQKPAKLFRKDVIANASSRKTYKSIAGRIGRTGYRDDLVKVSVAR 119 > At2g19730 Length=143 Score = 53.1 bits (126), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 36/123 (29%), Positives = 63/123 (51%), Gaps = 8/123 (6%) Query 53 AELLWQCVRRTSCFLKKSHG-----IVLTREPLNLTQKNTLRHSGLCHPRPLGLQLVGNN 107 +L+W+ V+ +CFL K G + ++E NLT ++ +HSGL + + + +Q + Sbjct 6 GQLIWEIVKNNNCFLVKQFGRGNSKVQFSKETNNLTNVHSYKHSGLANKKTVTIQAADKD 65 Query 108 AAVKL-SYRPKNPNKARFP-RRALCSKKFPKSHSKTKQLQQLVAQQRPDLVRLAKKRFHK 165 AV L + + K NK + +++ K+FP+ SK Q + RPDL + A R Sbjct 66 QAVVLATTKTKKQNKPKLSVNKSILKKEFPR-MSKAVANQVVDNYYRPDLKKAALARLSA 124 Query 166 LCK 168 + K Sbjct 125 ISK 127 > Hs13904866 Length=137 Score = 44.7 bits (104), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 0/59 (0%) Query 52 SAELLWQCVRRTSCFLKKSHGIVLTREPLNLTQKNTLRHSGLCHPRPLGLQLVGNNAAV 110 SA L W VR S FL K + + EP NL +N+ R++GL H + +G++ + V Sbjct 2 SAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGV 60 > CE06313 Length=126 Score = 38.9 bits (89), Expect = 0.005, Method: Compositional matrix adjust. Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 2/73 (2%) Query 52 SAELLWQCVRRTSCFLKKSHGIV--LTREPLNLTQKNTLRHSGLCHPRPLGLQLVGNNAA 109 S L+WQ +R S FL+ GI + E NL + N+ ++SGL + + + Sbjct 2 SDALVWQVIRNNSAFLRTQRGIGKRFSTEKFNLKKVNSPKYSGLANKHAIDVSAAAKGVV 61 Query 110 VKLSYRPKNPNKA 122 V P KA Sbjct 62 VSTKNEKGRPAKA 74 > 7292335 Length=144 Score = 37.7 bits (86), Expect = 0.011, Method: Compositional matrix adjust. Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Query 52 SAELLWQCVRRTSCFLKKSHGIV--LTREPLNLTQKNTLRHSGLCHPRPLGL 101 S+ L W +R + FL K + + EP NL ++ R+SG+ H + LG+ Sbjct 4 SSHLNWLIIRNNNAFLLKKRDVKKPFSTEPNNLASVSSYRYSGIVHKKTLGV 55 > 7292336 Length=165 Score = 36.2 bits (82), Expect = 0.036, Method: Compositional matrix adjust. Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Query 52 SAELLWQCVRRTSCFLKKSHGIV--LTREPLNLTQKNTLRHSGLCHPRPLGL 101 S+ L W +R + FL K + + EP NL ++ R+SG+ H + LG+ Sbjct 4 SSHLNWLIIRNNNAFLLKKRDVKKPFSTEPNNLASVSSYRYSGIVHKKTLGV 55 > YNL040w Length=456 Score = 28.9 bits (63), Expect = 5.9, Method: Compositional matrix adjust. Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 0/66 (0%) Query 5 KTKQLQQLVAQQRPDLVRLAKKRFHKLCKTSPKPAQAEQQQQQQKMASAELLWQCVRRTS 64 +TKQ+QQL +++ + RLA+ +L T + +++ + ELL Q + S Sbjct 310 QTKQIQQLNKREQYWIKRLARTASEELMNTLKASGKKRAYFMEEEYGTLELLLQIHKEVS 369 Query 65 CFLKKS 70 FLK Sbjct 370 NFLKDD 375 Lambda K H 0.318 0.128 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2815454148 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40