bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1504_orf2 Length=63 Score E Sequences producing significant alignments: (Bits) Value Hs4501855 80.5 7e-16 At1g36180 79.7 1e-15 Hs4826637 78.6 2e-15 At1g36160 77.4 6e-15 YNR016c 75.5 2e-14 SPAC56E4.04c 72.8 2e-13 CE14734 72.8 2e-13 7304119 70.5 7e-13 CE20115 70.5 7e-13 YMR207c 69.7 1e-12 > Hs4501855 Length=2483 Score = 80.5 bits (197), Expect = 7e-16, Method: Composition-based stats. Identities = 37/53 (69%), Positives = 46/53 (86%), Gaps = 0/53 (0%) Query 5 LGVENLRGSGKIAGETSLAYDEVFTLSLVSGRSVGIGAYIVRLAQRCIQQKTS 57 LGVENLRGSG IAGE+SLAY+E+ T+SLV+ R++GIGAY+VRL QR IQ + S Sbjct 1928 LGVENLRGSGMIAGESSLAYEEIVTISLVTCRAIGIGAYLVRLGQRVIQVENS 1980 > At1g36180 Length=2359 Score = 79.7 bits (195), Expect = 1e-15, Method: Composition-based stats. Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 0/55 (0%) Query 5 LGVENLRGSGKIAGETSLAYDEVFTLSLVSGRSVGIGAYIVRLAQRCIQQKTSPL 59 LGVENL GSG IAG S AY+E FTL+ VSGRSVGIGAY+ RL RCIQ+ P+ Sbjct 1814 LGVENLTGSGAIAGAYSRAYNETFTLTFVSGRSVGIGAYLARLGMRCIQRLDQPI 1868 > Hs4826637 Length=2346 Score = 78.6 bits (192), Expect = 2e-15, Method: Composition-based stats. Identities = 36/55 (65%), Positives = 46/55 (83%), Gaps = 0/55 (0%) Query 5 LGVENLRGSGKIAGETSLAYDEVFTLSLVSGRSVGIGAYIVRLAQRCIQQKTSPL 59 +G ENLRGSG IAGE+SLAY+E+ T+SLV+ R++GIGAY+VRL QR IQ + S L Sbjct 1792 IGPENLRGSGMIAGESSLAYNEIITISLVTSRAIGIGAYLVRLGQRTIQVENSHL 1846 > At1g36160 Length=2247 Score = 77.4 bits (189), Expect = 6e-15, Method: Composition-based stats. Identities = 35/55 (63%), Positives = 42/55 (76%), Gaps = 0/55 (0%) Query 5 LGVENLRGSGKIAGETSLAYDEVFTLSLVSGRSVGIGAYIVRLAQRCIQQKTSPL 59 +GVENL GSG IAG S AY+E FTL+ VSGR+VGIGAY+ RL RCIQ+ P+ Sbjct 1702 IGVENLTGSGAIAGAYSKAYNETFTLTFVSGRTVGIGAYLARLGMRCIQRLDQPI 1756 > YNR016c Length=2233 Score = 75.5 bits (184), Expect = 2e-14, Method: Composition-based stats. Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 0/55 (0%) Query 5 LGVENLRGSGKIAGETSLAYDEVFTLSLVSGRSVGIGAYIVRLAQRCIQQKTSPL 59 LGVE LRGSG IAG TS AY ++FT++LV+ RSVGIGAY+VRL QR IQ + P+ Sbjct 1700 LGVECLRGSGLIAGATSRAYHDIFTITLVTCRSVGIGAYLVRLGQRAIQVEGQPI 1754 > SPAC56E4.04c Length=2280 Score = 72.8 bits (177), Expect = 2e-13, Method: Composition-based stats. Identities = 34/55 (61%), Positives = 44/55 (80%), Gaps = 0/55 (0%) Query 5 LGVENLRGSGKIAGETSLAYDEVFTLSLVSGRSVGIGAYIVRLAQRCIQQKTSPL 59 LGVE LRGSG IAG TS AY+++FT +LV+ R+VGIGAY+VRL QR +Q + P+ Sbjct 1741 LGVECLRGSGLIAGVTSRAYNDIFTCTLVTCRAVGIGAYLVRLGQRAVQIEGQPI 1795 > CE14734 Length=2054 Score = 72.8 bits (177), Expect = 2e-13, Method: Composition-based stats. Identities = 36/59 (61%), Positives = 43/59 (72%), Gaps = 0/59 (0%) Query 1 EGQHLGVENLRGSGKIAGETSLAYDEVFTLSLVSGRSVGIGAYIVRLAQRCIQQKTSPL 59 + + +GVENL+GSG IAGET+ AY EV T V+GRSVGIGAY RLA R +Q K S L Sbjct 1543 KNEKIGVENLQGSGLIAGETARAYAEVPTYCYVTGRSVGIGAYTARLAHRIVQHKQSHL 1601 > 7304119 Length=2348 Score = 70.5 bits (171), Expect = 7e-13, Method: Composition-based stats. Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 0/53 (0%) Query 5 LGVENLRGSGKIAGETSLAYDEVFTLSLVSGRSVGIGAYIVRLAQRCIQQKTS 57 LGVENLR +G IAGETS AY+E+ T+++V+ R++GIG+Y+VRL QR IQ S Sbjct 1789 LGVENLRYAGLIAGETSQAYEEIVTIAMVTCRTIGIGSYVVRLGQRVIQIDNS 1841 > CE20115 Length=1657 Score = 70.5 bits (171), Expect = 7e-13, Method: Composition-based stats. Identities = 34/59 (57%), Positives = 43/59 (72%), Gaps = 0/59 (0%) Query 1 EGQHLGVENLRGSGKIAGETSLAYDEVFTLSLVSGRSVGIGAYIVRLAQRCIQQKTSPL 59 + +++GVENL GSG I GETS AY E+ T V+GRSVGIGAY RLA+R IQ + + L Sbjct 1223 KNEYIGVENLMGSGAIGGETSRAYREIPTYCYVTGRSVGIGAYTARLARRIIQHEKAHL 1281 > YMR207c Length=2123 Score = 69.7 bits (169), Expect = 1e-12, Method: Composition-based stats. Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 0/55 (0%) Query 5 LGVENLRGSGKIAGETSLAYDEVFTLSLVSGRSVGIGAYIVRLAQRCIQQKTSPL 59 LGVE L+GSG IAG TS AY ++FT++ V+ RSVGIG+Y+VRL QR IQ + P+ Sbjct 1595 LGVECLQGSGLIAGATSKAYRDIFTITAVTCRSVGIGSYLVRLGQRTIQVEDKPI 1649 Lambda K H 0.321 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1172754882 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40