bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1849_orf2 Length=136 Score E Sequences producing significant alignments: (Bits) Value At5g09920 57.4 8e-09 Hs4758574 50.4 1e-06 CE28327_2 37.0 0.010 ECU08g0765 33.5 0.11 SPBC337.14 33.5 0.13 CE01334 33.1 0.14 YJL140w 32.7 0.21 Hs4557225 30.0 1.2 7298235 30.0 1.2 SPBC30B4.05 30.0 1.4 7298361 28.9 2.9 Hs4502013 28.5 4.0 Hs7524346 28.5 4.2 CE21011 27.3 7.9 7302810 27.3 8.2 At4g12760 27.3 9.0 CE28344 26.9 9.7 > At5g09920 Length=138 Score = 57.4 bits (137), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 39/100 (39%), Positives = 55/100 (55%), Gaps = 5/100 (5%) Query 18 LGPEFKNAKCLNLCELQLILG---DQLRLSVARPA-EAHNLIKASYEYASRFGKMTVRTA 73 +G EF AKCL CE+ LIL +QL+ P + + + S +Y RF + A Sbjct 14 IGDEFLKAKCLMNCEVSLILEHKFEQLQQISEDPMNQVSQVFEKSLQYVKRFSRYKNPDA 73 Query 74 VVEIRKHLEREGDLQQFELALLVNLLPRTPDEAKAHIPSL 113 V ++R+ L R L +FEL +L NL P T +EA A +PSL Sbjct 74 VRQVREILSRH-QLTEFELCVLGNLCPETVEEAVAMVPSL 112 > Hs4758574 Length=142 Score = 50.4 bits (119), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 37/115 (32%), Positives = 56/115 (48%), Gaps = 4/115 (3%) Query 21 EFKNAKCLNLCELQLILG--DQLRLSVARPAEAHNLIKASYEYASRFGKMTVRTAVVEIR 78 EF+ A+ L E+ ++L Q S E + + Y +RF + R + +R Sbjct 25 EFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVR 84 Query 79 KHLEREGDLQQFELALLVNLLPRTPDEAKAHIPSLI-RLSAARLSRIIDTLEVFR 132 L + L +FELA L NL P T +E+KA IPSL R L +I+D ++ R Sbjct 85 SLL-LQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKR 138 > CE28327_2 Length=133 Score = 37.0 bits (84), Expect = 0.010, Method: Compositional matrix adjust. Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 2/74 (2%) Query 61 YASRFGKMTVRTAVVEIRKHLEREGDLQQFELALLVNLLPRTPDEAKAHIPSL-IRLSAA 119 YA R + R + +R E L +FE+A + NL P +EAKA +PSL ++ + Sbjct 59 YARRMSRFKNRETIRAVRAIF-SEKHLHKFEVAQIANLCPENAEEAKALVPSLENKIEES 117 Query 120 RLSRIIDTLEVFRV 133 L ++ L+ R Sbjct 118 ELEEVLKDLQSKRT 131 > ECU08g0765 Length=104 Score = 33.5 bits (75), Expect = 0.11, Method: Compositional matrix adjust. Identities = 20/79 (25%), Positives = 41/79 (51%), Gaps = 1/79 (1%) Query 35 LILGDQLRLSVARPAEAHNLIKASYEYASRFGKMTVRTAVVEIRKHLEREGDLQQFELAL 94 L+ G + R + A + +++ Y F ++ ++ ++R L G + E+AL Sbjct 8 LLEGQKERFRADFRSNASKVFRSTLGYLDDFCRIKDKSVAEDLRTTLSGLG-FGEVEIAL 66 Query 95 LVNLLPRTPDEAKAHIPSL 113 +L P++ +EAK+ +PSL Sbjct 67 FGSLFPQSVEEAKSLVPSL 85 > SPBC337.14 Length=135 Score = 33.5 bits (75), Expect = 0.13, Method: Compositional matrix adjust. Identities = 31/120 (25%), Positives = 52/120 (43%), Gaps = 8/120 (6%) Query 18 LGPEFKNAKCLNLCELQLILGDQLRLSVARPAEAH----NLIKASYEYASRFGKMTVRTA 73 LGPEF+N L + E ++++ + + AR +++K + Y + F + A Sbjct 15 LGPEFENEDMLTVSEAKILI-ETVLAQRARETNGEIPMTDVMKKTVAYFNVFARFKTAEA 73 Query 74 VVEIRKHLEREGDLQQFELALLVNLLPRTPDEAKAHIPSLI-RLSAARLSRIIDTLEVFR 132 + L +FE A L L +EA+ IPSL ++ L I+D L R Sbjct 74 TYACERILGNR--FHKFERAQLGTLCCEDAEEARTLIPSLANKIDDQNLQGILDELSTLR 131 > CE01334 Length=739 Score = 33.1 bits (74), Expect = 0.14, Method: Compositional matrix adjust. Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 4/69 (5%) Query 38 GDQLRLSVARPAEAHNLIKASYEYASRFGKMTVRTAVVE----IRKHLEREGDLQQFELA 93 D +R ++R + +NL + S ++ SR + +R A+V HLER G + Sbjct 601 ADTVRTQLSRVMDKYNLRRVSTDFKSRDYYLNIRKALVAGFFMQVAHLERSGHYVTVKDN 660 Query 94 LLVNLLPRT 102 LVNL P T Sbjct 661 QLVNLHPST 669 > YJL140w Length=221 Score = 32.7 bits (73), Expect = 0.21, Method: Compositional matrix adjust. Identities = 26/75 (34%), Positives = 40/75 (53%), Gaps = 2/75 (2%) Query 55 IKASYEYASRFGKMTVRTAVVEIRKHLEREGDLQQFELALLVNLLPRTPDEAKAHIPSL- 113 +K + +Y + F + + V + + L+ G L FE+A L +L T DEAK IPSL Sbjct 141 LKNTMQYLTNFSRFRDQETVGAVIQLLKSTG-LHPFEVAQLGSLACDTADEAKTLIPSLN 199 Query 114 IRLSAARLSRIIDTL 128 ++S L RI+ L Sbjct 200 NKISDDELERILKEL 214 > Hs4557225 Length=1474 Score = 30.0 bits (66), Expect = 1.2, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 0/32 (0%) Query 88 QQFELALLVNLLPRTPDEAKAHIPSLIRLSAA 119 ++F AL V LP+T DE KAH I LS + Sbjct 1337 EEFPFALGVQTLPQTCDEPKAHTSFQISLSVS 1368 > 7298235 Length=1021 Score = 30.0 bits (66), Expect = 1.2, Method: Compositional matrix adjust. Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Query 91 ELALLVNLLPRTPDEAKAHIPSLIR--LSAARLSRI 124 EL L N + R PD+A H+P L++ LS RLS I Sbjct 188 ELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHI 223 > SPBC30B4.05 Length=967 Score = 30.0 bits (66), Expect = 1.4, Method: Compositional matrix adjust. Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 5/51 (9%) Query 60 EYASRFGK-MTVRTAVVEIRKH---LEREGDLQQF-ELALLVNLLPRTPDE 105 +Y GK M T+V+ IRKH +++ LQQF EL +L N+ R DE Sbjct 300 KYDGLVGKAMAFLTSVIRIRKHAEFFQQDQVLQQFIELVVLPNICLRESDE 350 > 7298361 Length=1441 Score = 28.9 bits (63), Expect = 2.9, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Query 83 REGDLQQFELALLVNLLPRT-PDEAKAHIPSLIRLSAARLSRIIDTLEVFRVHA 135 ++G + + ALL +L +T PD + P LI S +L ++ TL++ R HA Sbjct 157 KKGGIMKGTRALLAHLSSQTRPDNVQGE-PILIETSEKQLEEVVITLDIGRAHA 209 > Hs4502013 Length=239 Score = 28.5 bits (62), Expect = 4.0, Method: Compositional matrix adjust. Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 5/55 (9%) Query 29 NLCELQLILGDQLRLSVARPAEAHNLIKASYEYASRFGKMTVRTAVVE-IRKHLE 82 N C L GD LR VA +E +KA+ + GK+ VVE I K+LE Sbjct 38 NFCVCHLATGDMLRAMVASGSELGKKLKATMDA----GKLVSDEMVVELIEKNLE 88 > Hs7524346 Length=232 Score = 28.5 bits (62), Expect = 4.2, Method: Compositional matrix adjust. Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 5/55 (9%) Query 29 NLCELQLILGDQLRLSVARPAEAHNLIKASYEYASRFGKMTVRTAVVE-IRKHLE 82 N C L GD LR VA +E +KA+ + GK+ VVE I K+LE Sbjct 38 NFCVCHLATGDMLRAMVASGSELGKKLKATMDA----GKLVSDEMVVELIEKNLE 88 > CE21011 Length=650 Score = 27.3 bits (59), Expect = 7.9, Method: Compositional matrix adjust. Identities = 36/142 (25%), Positives = 60/142 (42%), Gaps = 16/142 (11%) Query 3 WPKMEASVPESLAGDLGPEFKNAKCLNLCELQLILGDQLRLSVARPAE---------AHN 53 +P + A + G +G F A C + EL+LI+ D + PAE Sbjct 162 FPSIIADMLSDAIGCVG--FSWAACPAMTELELIMLDWFGKMIGLPAEFLPLTENGKGGG 219 Query 54 LIKASYEYASRFGKMTVRTAVVEIRKHLEREGDLQQFELALLVNLLPRTPDEAKAHIPSL 113 +I++S AS +T+ A E+ K L + + E LL L+ EA + + Sbjct 220 VIQSS---ASECNFVTLLAARFEVMKELRQRFPFVE-EGLLLSKLIAYCSKEAHSSVEKA 275 Query 114 IRLSAARLSRIIDTLEVFRVHA 135 + +L RI++T FR+ Sbjct 276 CMIGMVKL-RILETDSKFRLRG 296 > 7302810 Length=571 Score = 27.3 bits (59), Expect = 8.2, Method: Compositional matrix adjust. Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 6/117 (5%) Query 13 SLAGDLGPEFKNAKCLNLCELQLILGDQLRLSVARPAEAHNLIKASYEYASRFGKMTVRT 72 SLA + F + + L L+ L D L+ + A ++++LI S G M + Sbjct 48 SLAKKIKTSFYSLQKFQLMSLKNSLIDHLKYA-AMMRDSNSLIVQLAVGISALGLMFSQW 106 Query 73 AVVEIRKHLEREGDLQQFELALLVNLLPRTPDEAKAHIPSLIRLSAARLSRIIDTLE 129 E++ + + + Q+ +ALL +L P+E + PS + + A +L+ +IDTLE Sbjct 107 DY-ELQDFVRKLSENPQYVMALL-EVLKVIPEETR---PSNLPVEAKKLNSVIDTLE 158 > At4g12760 Length=227 Score = 27.3 bits (59), Expect = 9.0, Method: Compositional matrix adjust. Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 11/54 (20%) Query 1 WCWPKMEASVPESLAGDLGPEFKNAKCLNLCELQLILGDQLRLSV--ARPAEAH 52 WC P G+L ++ C N+C++QL G+++ L++ R AEAH Sbjct 144 WC--------PICKKGELMENHRHIDC-NMCDMQLNKGEEVNLNILQERLAEAH 188 > CE28344 Length=705 Score = 26.9 bits (58), Expect = 9.7, Method: Compositional matrix adjust. Identities = 36/142 (25%), Positives = 60/142 (42%), Gaps = 16/142 (11%) Query 3 WPKMEASVPESLAGDLGPEFKNAKCLNLCELQLILGDQLRLSVARPAE---------AHN 53 +P + A + G +G F A C + EL+LI+ D + PAE Sbjct 162 FPSIIADMLSDAIGCVG--FSWAACPAMTELELIMLDWFGKMIGLPAEFLPLTENGKGGG 219 Query 54 LIKASYEYASRFGKMTVRTAVVEIRKHLEREGDLQQFELALLVNLLPRTPDEAKAHIPSL 113 +I++S AS +T+ A E+ K L + + E LL L+ EA + + Sbjct 220 VIQSS---ASECNFVTLLAARFEVMKELRQRFPFVE-EGLLLSKLIAYCSKEAHSSVEKA 275 Query 114 IRLSAARLSRIIDTLEVFRVHA 135 + +L RI++T FR+ Sbjct 276 CMIGMVKL-RILETDSKFRLRG 296 Lambda K H 0.321 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1425342594 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40