bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1869_orf1 Length=190 Score E Sequences producing significant alignments: (Bits) Value At1g29320 42.0 7e-04 7302188 37.4 0.018 Hs8922422 35.4 0.076 CE13313 33.9 0.22 At1g36070 33.5 0.29 YGL111w 32.0 0.73 YBR108w 30.0 3.2 At4g13530 29.6 3.4 7294394 28.5 9.3 > At1g29320 Length=468 Score = 42.0 bits (97), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 0/53 (0%) Query 57 GAIVGLGLDPAGEFLVAVGLGRYAYVFDAKSRKLREKVFLKQKLTCLLSGGGV 109 G+I + P + + + GL RY V+D K+R+L VFLKQ LT L+ G Sbjct 303 GSIRSVVRHPQHQVIASCGLDRYLRVYDVKTRQLISAVFLKQHLTGLVFDSGF 355 > 7302188 Length=419 Score = 37.4 bits (85), Expect = 0.018, Method: Compositional matrix adjust. Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 0/69 (0%) Query 36 AAACSDLQLAAVSVGGYKEAMGAIVGLGLDPAGEFLVAVGLGRYAYVFDAKSRKLREKVF 95 A D + V YK G I L LD G FL + L RY + D+++ L + + Sbjct 260 ALKAFDTRRMKTHVHTYKGFTGGISDLHLDATGRFLSSASLDRYVRIHDSETTVLLYQCY 319 Query 96 LKQKLTCLL 104 +K K T +L Sbjct 320 VKSKATKIL 328 > Hs8922422 Length=385 Score = 35.4 bits (80), Expect = 0.076, Method: Compositional matrix adjust. Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query 49 VGGYKEAMGAIVGLGLDPAGEFLVAVGLGRYAYVFDAKS-RKLREKVFLKQKLTCLLSGG 107 +G K G++ GL P+ L + GL R + ++ R L KV+LK +L CLL G Sbjct 262 LGCLKGLAGSVRGLQCHPSKPLLASCGLDRVLRIHGTQNPRGLEHKVYLKSQLNCLLLSG 321 > CE13313 Length=431 Score = 33.9 bits (76), Expect = 0.22, Method: Compositional matrix adjust. Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 0/53 (0%) Query 52 YKEAMGAIVGLGLDPAGEFLVAVGLGRYAYVFDAKSRKLREKVFLKQKLTCLL 104 +K G+I + P +VG+ R+ V D +SRKL K++ K +L +L Sbjct 251 FKGQAGSIRSITAHPTLPLAASVGIDRFLRVHDLQSRKLIHKIYCKTRLNRVL 303 > At1g36070 Length=451 Score = 33.5 bits (75), Expect = 0.29, Method: Compositional matrix adjust. Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 0/59 (0%) Query 35 SAAACSDLQLAAVSVGGYKEAMGAIVGLGLDPAGEFLVAVGLGRYAYVFDAKSRKLREK 93 +A D++ + S K MGAI GL P G FL + ++FD +S L+ + Sbjct 345 TACRLWDIRNPSESFAVLKGNMGAIRGLKFTPEGRFLAMAEPADFVHIFDTQSGFLQSQ 403 > YGL111w Length=463 Score = 32.0 bits (71), Expect = 0.73, Method: Compositional matrix adjust. Identities = 12/37 (32%), Positives = 24/37 (64%), Gaps = 0/37 (0%) Query 68 GEFLVAVGLGRYAYVFDAKSRKLREKVFLKQKLTCLL 104 G++L+ GL RY +FD K+ K+ KV++ ++ ++ Sbjct 372 GKYLLQGGLDRYVRIFDIKTNKMLVKVYVGSRINFIV 408 > YBR108w Length=848 Score = 30.0 bits (66), Expect = 3.2, Method: Composition-based stats. Identities = 22/67 (32%), Positives = 28/67 (41%), Gaps = 5/67 (7%) Query 103 LLSGGGVGAGGVKRCTATKGSAHTKHECGSSSDLNSSGEEQGSECDNSIDSEAATDDETE 162 L S G G G K T A KH S + E+ S NS D E ++DE E Sbjct 15 LKSAGKYGYQGTKYVAKTGYKASKKHYNNSKAR-----RERKSGKKNSSDEEYDSEDEME 69 Query 163 ISRRPVE 169 R+P + Sbjct 70 YERKPTD 76 > At4g13530 Length=263 Score = 29.6 bits (65), Expect = 3.4, Method: Compositional matrix adjust. Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 0/41 (0%) Query 64 LDPAGEFLVAVGLGRYAYVFDAKSRKLREKVFLKQKLTCLL 104 L A F+ V LGR Y K+R L+ KV L K+T L+ Sbjct 194 LSMAAAFVGFVMLGRRLYNMKKKTRSLQLKVLLDDKVTSLV 234 > 7294394 Length=1037 Score = 28.5 bits (62), Expect = 9.3, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 0/42 (0%) Query 130 CGSSSDLNSSGEEQGSECDNSIDSEAATDDETEISRRPVEAA 171 CGSS+ N+ QGS ++I+S A+ + + + RR + A Sbjct 838 CGSSNPPNAQNASQGSANGSTINSNASAMEASMLKRRLIAAG 879 Lambda K H 0.312 0.129 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3166472848 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40