bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2315_orf1 Length=70 Score E Sequences producing significant alignments: (Bits) Value At3g47370 35.8 0.019 At5g62300 33.5 0.11 At3g45030 33.1 0.14 7300661 32.3 0.23 Hs4506697 30.8 0.58 At1g12220 28.9 2.2 Hs18544255 28.9 2.4 Hs18547257 28.5 3.1 SPCC576.09 28.5 3.1 Hs9507223 27.3 6.8 > At3g47370 Length=122 Score = 35.8 bits (81), Expect = 0.019, Method: Compositional matrix adjust. Identities = 16/37 (43%), Positives = 27/37 (72%), Gaps = 0/37 (0%) Query 8 LAASMSKALKEGLEGEEQRLHRIRITLTSKDLKSIER 44 +A K K GLE +++H+IRITL+SK++K++E+ Sbjct 1 MAYEPMKPTKAGLEAPLEQIHKIRITLSSKNVKNLEK 37 > At5g62300 Length=124 Score = 33.5 bits (75), Expect = 0.11, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 25/31 (80%), Gaps = 0/31 (0%) Query 14 KALKEGLEGEEQRLHRIRITLTSKDLKSIER 44 K K GLE +++H+IRITL+SK++K++E+ Sbjct 9 KPGKAGLEEPLEQIHKIRITLSSKNVKNLEK 39 > At3g45030 Length=117 Score = 33.1 bits (74), Expect = 0.14, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 25/31 (80%), Gaps = 0/31 (0%) Query 14 KALKEGLEGEEQRLHRIRITLTSKDLKSIER 44 K K GLE +++H+IRITL+SK++K++E+ Sbjct 2 KPGKAGLEEPLEQIHKIRITLSSKNVKNLEK 32 > 7300661 Length=120 Score = 32.3 bits (72), Expect = 0.23, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 25/34 (73%), Gaps = 0/34 (0%) Query 10 ASMSKALKEGLEGEEQRLHRIRITLTSKDLKSIE 43 A+ K +++ G+ +HRIRITLTS++++S+E Sbjct 2 AAAPKDIEKPHVGDSASVHRIRITLTSRNVRSLE 35 > Hs4506697 Length=119 Score = 30.8 bits (68), Expect = 0.58, Method: Compositional matrix adjust. Identities = 13/21 (61%), Positives = 19/21 (90%), Gaps = 0/21 (0%) Query 24 EQRLHRIRITLTSKDLKSIER 44 E +HRIRITLTS+++KS+E+ Sbjct 14 EVAIHRIRITLTSRNVKSLEK 34 > At1g12220 Length=889 Score = 28.9 bits (63), Expect = 2.2, Method: Compositional matrix adjust. Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 15/85 (17%) Query 1 FIHPFSSLAASMSKALK---------------EGLEGEEQRLHRIRITLTSKDLKSIERG 45 +IH S AS+ KA++ E G +QRL ++++ LTS + + Sbjct 28 YIHNLSKNLASLQKAMRMLKARQYDVIRRLETEEFTGRQQRLSQVQVWLTSVLIIQNQFN 87 Query 46 EQQRKNDISAFLEVLKPFCSRYMGL 70 + R N++ L FCS+ + L Sbjct 88 DLLRSNEVELQRLCLCGFCSKDLKL 112 > Hs18544255 Length=130 Score = 28.9 bits (63), Expect = 2.4, Method: Compositional matrix adjust. Identities = 12/21 (57%), Positives = 19/21 (90%), Gaps = 0/21 (0%) Query 24 EQRLHRIRITLTSKDLKSIER 44 E +H+IRITLTS+++KS+E+ Sbjct 25 EVAIHQIRITLTSRNVKSLEK 45 > Hs18547257 Length=149 Score = 28.5 bits (62), Expect = 3.1, Method: Compositional matrix adjust. Identities = 11/18 (61%), Positives = 17/18 (94%), Gaps = 0/18 (0%) Query 27 LHRIRITLTSKDLKSIER 44 +HRIRIT+TS+ +KS+E+ Sbjct 48 IHRIRITVTSRKVKSLEK 65 > SPCC576.09 Length=118 Score = 28.5 bits (62), Expect = 3.1, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query 12 MSKALKEGLEGE-EQRLHRIRITLTSKDLKSIER 44 MS+ K+ E + +HRIRITLTS++++++E+ Sbjct 1 MSQVAKDQKEQQIPSTVHRIRITLTSRNVRNLEK 34 > Hs9507223 Length=533 Score = 27.3 bits (59), Expect = 6.8, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 0/36 (0%) Query 2 IHPFSSLAASMSKALKEGLEGEEQRLHRIRITLTSK 37 IH + L +M K + +GL E++ L I++T +K Sbjct 338 IHSITGLPPAMQKVMYKGLVPEDKTLREIKVTSGAK 373 Lambda K H 0.320 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1197219688 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40