bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2426_orf1 Length=165 Score E Sequences producing significant alignments: (Bits) Value At5g12190 72.0 5e-13 Hs7706326 70.1 2e-12 7295357 67.8 9e-12 CE27875 66.2 3e-11 At2g14870 58.9 5e-09 SPBC29A3.07c 57.4 1e-08 ECU02g0530 38.9 0.005 Hs21314767 37.4 0.012 HsM14916449 37.4 0.013 SPAC3G6.04 36.2 0.028 At1g71770 36.2 0.034 At5g07290 35.8 0.039 At1g02840 35.4 0.055 7290796 35.4 0.055 ECU07g0340 35.0 0.059 At4g19610 35.0 0.073 At4g02430 34.3 0.10 At3g49430 34.3 0.11 Hs5902076 33.5 0.19 YLL046c 33.1 0.25 Hs4506903 32.7 0.30 Hs17441906 32.7 0.32 ECU08g0520 32.7 0.33 CE09667 32.7 0.36 At4g34110 32.3 0.39 Hs4503131 32.3 0.42 Hs7705365 32.3 0.42 At1g22760 32.3 0.43 7294907 32.3 0.44 Hs7662250 32.3 0.44 Hs17482675 32.3 0.49 SPBC1861.04c 32.0 0.58 Hs5031703 32.0 0.58 At3g52380 32.0 0.63 CE05167 31.6 0.65 YPL178w 31.6 0.72 SPBP22H7.02c 31.6 0.75 CE00109 31.6 0.79 Hs20556145 31.2 0.91 YNL110c 31.2 0.94 At5g60980 31.2 0.98 Hs14149675 31.2 1.0 Hs19923387 31.2 1.1 Hs8922073 31.2 1.1 CE24139 30.8 1.1 7296892 30.8 1.1 CE02197 30.4 1.5 CE08369 30.4 1.6 CE18963 30.4 1.8 SPBC13A2.01c 30.0 2.0 > At5g12190 Length=124 Score = 72.0 bits (175), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 31/45 (68%), Positives = 36/45 (80%), Gaps = 0/45 (0%) Query 120 RGRPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIRRG 164 R RL PEV+R+LYVRNLPF I EE+YD+FGKYG+IRQIR G Sbjct 7 RKSNTRLPPEVNRVLYVRNLPFNITSEEMYDIFGKYGAIRQIRIG 51 > Hs7706326 Length=125 Score = 70.1 bits (170), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%) Query 125 RLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIRRGT 165 RL PEV+RILY+RNLP+KI EE+YD+FGKYG IRQIR G Sbjct 12 RLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGN 52 > 7295357 Length=121 Score = 67.8 bits (164), Expect = 9e-12, Method: Compositional matrix adjust. Identities = 28/41 (68%), Positives = 36/41 (87%), Gaps = 0/41 (0%) Query 125 RLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIRRGT 165 RL PEV+R+LYVRNLP+KI +E+YD+FGK+G+IRQIR G Sbjct 8 RLPPEVNRLLYVRNLPYKITSDEMYDIFGKFGAIRQIRVGN 48 > CE27875 Length=215 Score = 66.2 bits (160), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 26/46 (56%), Positives = 38/46 (82%), Gaps = 0/46 (0%) Query 120 RGRPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIRRGT 165 + R +L PEV+RILY++NLP+KI EE+Y++FGK+G++RQIR G Sbjct 7 QNRGAKLPPEVNRILYIKNLPYKITTEEMYEIFGKFGAVRQIRVGN 52 > At2g14870 Length=101 Score = 58.9 bits (141), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%) Query 125 RLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIRRG 164 RL PEV+R+LY+ NLPF I E+ YD+FG+Y +IRQ+R G Sbjct 13 RLPPEVTRLLYICNLPFSITSEDTYDLFGRYSTIRQVRIG 52 > SPBC29A3.07c Length=137 Score = 57.4 bits (137), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 0/43 (0%) Query 123 PQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIRRGT 165 P + EV+ IL+++NL FKI EE+YD+FG+YG +RQIR G Sbjct 3 PSTVNQEVNSILFIKNLSFKITAEEMYDLFGRYGPVRQIRLGN 45 > ECU02g0530 Length=93 Score = 38.9 bits (89), Expect = 0.005, Method: Compositional matrix adjust. Identities = 16/35 (45%), Positives = 28/35 (80%), Gaps = 0/35 (0%) Query 131 SRILYVRNLPFKINGEELYDVFGKYGSIRQIRRGT 165 ++IL+VRNLP ++ +++ ++FG+YG+I QIR G Sbjct 6 TQILFVRNLPKDVSKDKVVELFGEYGTIVQIRIGV 40 > Hs21314767 Length=217 Score = 37.4 bits (85), Expect = 0.012, Method: Compositional matrix adjust. Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Query 126 LAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 LAP S + YV NLPF + +LY +F KYG + ++ Sbjct 5 LAPSKSTV-YVSNLPFSLTNNDLYRIFSKYGKVVKV 39 > HsM14916449 Length=217 Score = 37.4 bits (85), Expect = 0.013, Method: Compositional matrix adjust. Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Query 126 LAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 LAP S + YV NLPF + +LY +F KYG + ++ Sbjct 5 LAPSKSTV-YVSNLPFSLTNNDLYRIFSKYGKVVKV 39 > SPAC3G6.04 Length=369 Score = 36.2 bits (82), Expect = 0.028, Method: Compositional matrix adjust. Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 0/51 (0%) Query 112 QPAPLLAGRGRPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIR 162 +PA L+ Q E S IL+V NL F+ +L + FG+ G IR++R Sbjct 208 KPANTLSKTASIQSSKKEPSSILFVGNLDFETTDADLKEHFGQVGQIRRVR 258 > At1g71770 Length=668 Score = 36.2 bits (82), Expect = 0.034, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 0/25 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSI 158 +YV+NLP +I +EL FGKYG I Sbjct 227 VYVKNLPKEITDDELKKTFGKYGDI 251 Score = 30.4 bits (67), Expect = 1.7, Method: Compositional matrix adjust. Identities = 10/25 (40%), Positives = 19/25 (76%), Gaps = 0/25 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSI 158 LY++NL +N E+L ++F +YG++ Sbjct 330 LYLKNLDDSVNDEKLKEMFSEYGNV 354 > At5g07290 Length=907 Score = 35.8 bits (81), Expect = 0.039, Method: Composition-based stats. Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 0/30 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQIRR 163 L+V NL I+ EEL+ +F YG IR++RR Sbjct 297 LWVNNLDSSISNEELHGIFSSYGEIREVRR 326 > At1g02840 Length=283 Score = 35.4 bits (80), Expect = 0.055, Method: Compositional matrix adjust. Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 126 LAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 ++ SR +YV NLP I E+ D+F KYG + QI Sbjct 1 MSSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQI 36 > 7290796 Length=334 Score = 35.4 bits (80), Expect = 0.055, Method: Compositional matrix adjust. Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQ 160 LYV NLP I ++L +FGKYGSI Q Sbjct 173 LYVTNLPRTITDDQLDTIFGKYGSIVQ 199 > ECU07g0340 Length=333 Score = 35.0 bits (79), Expect = 0.059, Method: Compositional matrix adjust. Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 0/40 (0%) Query 123 PQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIR 162 P+ L P I+Y+ N+ I E+L D+F K G I+ +R Sbjct 133 PKELRPPDESIVYISNIDLNIEEEQLEDIFKKMGEIKGVR 172 > At4g19610 Length=772 Score = 35.0 bits (79), Expect = 0.073, Method: Composition-based stats. Identities = 15/29 (51%), Positives = 21/29 (72%), Gaps = 0/29 (0%) Query 133 ILYVRNLPFKINGEELYDVFGKYGSIRQI 161 IL V+NLPF +EL +FGK+GS+ +I Sbjct 410 ILLVKNLPFASTEKELAQMFGKFGSLDKI 438 > At4g02430 Length=294 Score = 34.3 bits (77), Expect = 0.10, Method: Compositional matrix adjust. Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 126 LAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 ++ SR +YV NLP I E+ D+F KYG + QI Sbjct 1 MSSRSSRTIYVGNLPGDIREREVEDLFSKYGPVVQI 36 > At3g49430 Length=243 Score = 34.3 bits (77), Expect = 0.11, Method: Compositional matrix adjust. Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 0/36 (0%) Query 126 LAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 ++ SR +YV NLP I E+ D+F KYG I I Sbjct 1 MSGRFSRSIYVGNLPGDIREHEIEDIFYKYGRIVDI 36 > Hs5902076 Length=248 Score = 33.5 bits (75), Expect = 0.19, Method: Compositional matrix adjust. Identities = 18/35 (51%), Positives = 23/35 (65%), Gaps = 4/35 (11%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQI----RRG 164 +YV NLP I +++ DVF KYG+IR I RRG Sbjct 18 IYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRG 52 > YLL046c Length=249 Score = 33.1 bits (74), Expect = 0.25, Method: Compositional matrix adjust. Identities = 18/81 (22%), Positives = 31/81 (38%), Gaps = 4/81 (4%) Query 77 FSAFFAGCSLSGVPRECCGAAAAAAAAAAAKSPAMQPAPLLAGRGRPQRLAPEV----SR 132 F F G +L V + G + + ++ AP++ + Sbjct 81 FIEFQEGVNLKKVKEKMNGKIFMNEKIVIENILTKEEKSFEKNQKSNKKTAPDLKPLSTN 140 Query 133 ILYVRNLPFKINGEELYDVFG 153 LYV+N+P K E+L +FG Sbjct 141 TLYVKNIPMKSTNEDLAKIFG 161 > Hs4506903 Length=221 Score = 32.7 bits (73), Expect = 0.30, Method: Compositional matrix adjust. Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQI 161 +YV NLP + ++L D+F KYG IR+I Sbjct 16 IYVGNLPTDVREKDLEDLFYKYGRIREI 43 > Hs17441906 Length=334 Score = 32.7 bits (73), Expect = 0.32, Method: Compositional matrix adjust. Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 7/58 (12%) Query 111 MQPAPLLA----GRGRPQRLA--PEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIR 162 M P P+ G PQR+ P+ S L++ NLP +++ EL D F YG++ ++ Sbjct 192 MGPRPICEAGEQGDIEPQRVVRHPD-SHQLFIGNLPHEVDKSELKDFFQNYGNVVELH 248 > ECU08g0520 Length=432 Score = 32.7 bits (73), Expect = 0.33, Method: Compositional matrix adjust. Identities = 13/41 (31%), Positives = 25/41 (60%), Gaps = 0/41 (0%) Query 121 GRPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 G + + SR +++RN+P + N + + DVF +YG I ++ Sbjct 103 GESEERMIKYSRKIFIRNVPAEANEQFVRDVFKEYGEIEEV 143 > CE09667 Length=154 Score = 32.7 bits (73), Expect = 0.36, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 0/40 (0%) Query 122 RPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 R Q A S LYV NL + +++Y++FG+ G +R++ Sbjct 27 RDQETALRTSCTLYVGNLSYYTKEDQVYELFGRAGDVRRV 66 > At4g34110 Length=629 Score = 32.3 bits (72), Expect = 0.39, Method: Compositional matrix adjust. Identities = 11/29 (37%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQIR 162 LYV +L F + +L+D FG+ G++ +R Sbjct 38 LYVGDLDFNVTDSQLFDAFGQMGTVVTVR 66 > Hs4503131 Length=781 Score = 32.3 bits (72), Expect = 0.42, Method: Compositional matrix adjust. Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Query 107 KSPAMQPAPLLAGRGRPQRLAPEVSRILYVRNLPF--KINGEELYDVFGKYGSIRQIR 162 S A AP L+G+G P+ + S++LY F E++ D+ G+Y R R Sbjct 36 HSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQR 93 > Hs7705365 Length=960 Score = 32.3 bits (72), Expect = 0.42, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 2/53 (3%) Query 110 AMQPAPLLAGRGRPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIR 162 A +PA LA + + R S+IL VRN+PF+ + E+ ++F +G ++ +R Sbjct 812 ATKPAVTLARKKQVPR-KQTTSKIL-VRNIPFQAHSREIRELFSTFGELKTVR 862 Score = 30.4 bits (67), Expect = 1.8, Method: Composition-based stats. Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 0/28 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQI 161 L+VRNLP+ E+L +F KYG + ++ Sbjct 404 LFVRNLPYTSTEEDLEKLFSKYGPLSEL 431 > At1g22760 Length=660 Score = 32.3 bits (72), Expect = 0.43, Method: Compositional matrix adjust. Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 0/25 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSI 158 +YV+NLP +I +EL FGK+G I Sbjct 231 VYVKNLPKEIGEDELRKTFGKFGVI 255 > 7294907 Length=918 Score = 32.3 bits (72), Expect = 0.44, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Query 121 GRPQRLAPEVSRI---LYVRNLPFKINGEELYDVFGKYGSIRQIR 162 G +RLA + + + VRN+PF+ E+ D+F +G +R +R Sbjct 771 GAQRRLASQKKQTGTKILVRNIPFQAQYREVRDIFKAFGELRSLR 815 > Hs7662250 Length=960 Score = 32.3 bits (72), Expect = 0.44, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 2/53 (3%) Query 110 AMQPAPLLAGRGRPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIR 162 A +PA LA + + R S+IL VRN+PF+ + E+ ++F +G ++ +R Sbjct 812 ATKPAVTLARKKQVPR-KQTTSKIL-VRNIPFQAHSREIRELFSTFGELKTVR 862 Score = 30.0 bits (66), Expect = 1.9, Method: Composition-based stats. Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 0/28 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQI 161 L+VRNLP+ E+L +F KYG + ++ Sbjct 404 LFVRNLPYTSTEEDLEKLFSKYGPLSEL 431 > Hs17482675 Length=175 Score = 32.3 bits (72), Expect = 0.49, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 8/75 (10%) Query 85 SLSGVPRECCGAAAAA-AAAAAAKSPAMQPAPLLAGRGRPQRLAPEVSRILYVRNLPFKI 143 SL+ + CG+ A A A + P ++ +L G R + ++VRNLPF Sbjct 66 SLTCMGLAMCGSGGATFDHAIALQVPLVEQETMLLGMARK-------ACQIFVRNLPFNF 118 Query 144 NGEELYDVFGKYGSI 158 + L D F +YG + Sbjct 119 TWKMLKDKFNEYGHM 133 > SPBC1861.04c Length=1014 Score = 32.0 bits (71), Expect = 0.58, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 0/43 (0%) Query 120 RGRPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIR 162 R P+ A R LYV N+ FK+N +++ F YG + +R Sbjct 745 RRTPRSGAVYEGRELYVTNIDFKVNEKDVETFFRDYGQVESVR 787 > Hs5031703 Length=466 Score = 32.0 bits (71), Expect = 0.58, Method: Compositional matrix adjust. Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 0/32 (0%) Query 131 SRILYVRNLPFKINGEELYDVFGKYGSIRQIR 162 S L++ NLP +++ EL D F YG++ ++R Sbjct 339 SHQLFIGNLPHEVDKSELKDFFQSYGNVVELR 370 > At3g52380 Length=329 Score = 32.0 bits (71), Expect = 0.63, Method: Compositional matrix adjust. Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQIR 162 LYV NLP+ I EL +FG+ G++ ++ Sbjct 118 LYVGNLPYTITSSELSQIFGEAGTVVDVQ 146 > CE05167 Length=836 Score = 31.6 bits (70), Expect = 0.65, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 22/32 (68%), Gaps = 0/32 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQIRRGT 165 ++VRN+ F+ +EL +F K+G++ +RR T Sbjct 685 VFVRNVHFQATDDELKALFSKFGTVTSVRRVT 716 > YPL178w Length=208 Score = 31.6 bits (70), Expect = 0.72, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 0/34 (0%) Query 131 SRILYVRNLPFKINGEELYDVFGKYGSIRQIRRG 164 S +YV NL F + E++Y++F K G+I++I G Sbjct 45 SSTIYVGNLSFYTSEEQIYELFSKCGTIKRIIMG 78 > SPBP22H7.02c Length=833 Score = 31.6 bits (70), Expect = 0.75, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Query 128 PEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIR 162 P+ ++IL ++NLPF+ +++ + G YG +R +R Sbjct 718 PKGTKIL-IKNLPFEATKKDVQSLLGAYGQLRSVR 751 > CE00109 Length=372 Score = 31.6 bits (70), Expect = 0.79, Method: Compositional matrix adjust. Identities = 13/43 (30%), Positives = 24/43 (55%), Gaps = 0/43 (0%) Query 116 LLAGRGRPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSI 158 L A + RP P SR +++ LP ++ E+++ FG +G + Sbjct 42 LEASKKRPISAEPLYSRKVFIGGLPIDVSEEQVWATFGAFGKV 84 > Hs20556145 Length=152 Score = 31.2 bits (69), Expect = 0.91, Method: Compositional matrix adjust. Identities = 17/73 (23%), Positives = 27/73 (36%), Gaps = 0/73 (0%) Query 78 SAFFAGCSLSGVPRECCGAAAAAAAAAAAKSPAMQPAPLLAGRGRPQRLAPEVSRILYVR 137 S + GC++ G ++C A A + PL + P + + Sbjct 57 SGYSYGCAVDGNGKDCFSAHETPEHTAGTLVMPKETTPLAENQDEDPLEDPHLHLNIEES 116 Query 138 NLPFKINGEELYD 150 N F + EELYD Sbjct 117 NQEFMVKSEELYD 129 > YNL110c Length=220 Score = 31.2 bits (69), Expect = 0.94, Method: Compositional matrix adjust. Identities = 12/43 (27%), Positives = 25/43 (58%), Gaps = 0/43 (0%) Query 120 RGRPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIR 162 + + ++ E S I+YV LP + +EL F ++G ++++R Sbjct 79 KSKDKKTLEEYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVR 121 > At5g60980 Length=459 Score = 31.2 bits (69), Expect = 0.98, Method: Compositional matrix adjust. Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 0/27 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQ 160 +YVRNLPF +L +VF +G+I+ Sbjct 295 IYVRNLPFDSTPTQLEEVFKNFGAIKH 321 > Hs14149675 Length=616 Score = 31.2 bits (69), Expect = 1.0, Method: Compositional matrix adjust. Identities = 11/31 (35%), Positives = 20/31 (64%), Gaps = 0/31 (0%) Query 132 RILYVRNLPFKINGEELYDVFGKYGSIRQIR 162 R ++V N+P++ E+L D+F + GS+ R Sbjct 16 RSVFVGNIPYEATEEQLKDIFSEVGSVVSFR 46 > Hs19923387 Length=156 Score = 31.2 bits (69), Expect = 1.1, Method: Compositional matrix adjust. Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 0/28 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQI 161 LYV NL F E++Y++F K G I++I Sbjct 42 LYVGNLSFYTTEEQIYELFSKSGDIKKI 69 > Hs8922073 Length=377 Score = 31.2 bits (69), Expect = 1.1, Method: Compositional matrix adjust. Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 8/61 (13%) Query 102 AAAAAKSPAMQPAPLLAGRGRPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 AA P QP+ + +P+RL +V N+PF+ +L +FG++G I + Sbjct 75 AAPTDGQPQTQPSENTENKSQPKRL--------HVSNIPFRFRDPDLRQMFGQFGKILDV 126 Query 162 R 162 Sbjct 127 E 127 > CE24139 Length=235 Score = 30.8 bits (68), Expect = 1.1, Method: Compositional matrix adjust. Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 0/28 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQI 161 +YV NLP + +E+ D+F KYG I+ + Sbjct 11 VYVGNLPGDVREKEVEDIFHKYGRIKYV 38 > 7296892 Length=416 Score = 30.8 bits (68), Expect = 1.1, Method: Compositional matrix adjust. Identities = 18/36 (50%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Query 128 PEVSRI--LYVRNLPFKINGEELYDVFGKYGSIRQI 161 PE I LYV NLP +I EL D F ++G IR I Sbjct 224 PEDRNITTLYVGNLPEEITEPELRDQFYQFGEIRSI 259 > CE02197 Length=256 Score = 30.4 bits (67), Expect = 1.5, Method: Compositional matrix adjust. Identities = 13/26 (50%), Positives = 19/26 (73%), Gaps = 0/26 (0%) Query 136 VRNLPFKINGEELYDVFGKYGSIRQI 161 V NLP ++N +EL D+FGK G + +I Sbjct 180 VTNLPQEMNEDELRDLFGKIGRVIRI 205 > CE08369 Length=454 Score = 30.4 bits (67), Expect = 1.6, Method: Compositional matrix adjust. Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 0/37 (0%) Query 122 RPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSI 158 R + P + +++ NL F + ++LY+VFG G I Sbjct 178 RQHNIEPPLCERIFIANLAFNVGTDKLYEVFGMAGKI 214 > CE18963 Length=872 Score = 30.4 bits (67), Expect = 1.8, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Query 124 QRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIR 162 Q+ E +++L VRNLPF+ + +E+ +F +G+++ IR Sbjct 741 QKEQGECTKLL-VRNLPFEASVKEVETLFETFGAVKTIR 778 Score = 29.3 bits (64), Expect = 3.9, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 20/29 (68%), Gaps = 0/29 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQIR 162 L++RNLP+ ++L +F KYG + +++ Sbjct 281 LFLRNLPYATKEDDLQFLFKKYGEVSEVQ 309 > SPBC13A2.01c Length=182 Score = 30.0 bits (66), Expect = 2.0, Method: Compositional matrix adjust. Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 0/35 (0%) Query 127 APEVSRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 A + S +YV NL F E++Y +F K G IR+I Sbjct 27 AVKQSNCVYVGNLSFYTTEEQIYALFSKCGEIRRI 61 Lambda K H 0.323 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2353551590 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40