bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2735_orf1 Length=149 Score E Sequences producing significant alignments: (Bits) Value At1g03910 78.6 4e-15 CE20137 73.6 1e-13 7295594 68.6 4e-12 SPBC2F12.12c 42.0 4e-04 CE19234 36.2 0.022 CE29066 36.2 0.023 Hs4757866 31.6 0.54 Hs15295343 31.6 0.54 Hs15147337 30.8 1.1 ECU05g1530 29.3 3.0 At5g48600 28.5 5.1 Hs17448764 28.1 6.9 > At1g03910 Length=672 Score = 78.6 bits (192), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Query 98 VMADSSEMKL-KQHYGWEEKYRPRKPRFFNRVRTCYFWNKYNQTHYDHDNPPP 149 + ++E+ L + Y W +KYRPRKP++FNRV T Y WNKYNQTHYDHDNPPP Sbjct 532 IFGSNAEVNLDSEVYWWHDKYRPRKPKYFNRVHTGYEWNKYNQTHYDHDNPPP 584 > CE20137 Length=667 Score = 73.6 bits (179), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 30/56 (53%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Query 94 PDEEVMADSSEMKLKQHYGWEEKYRPRKPRFFNRVRTCYFWNKYNQTHYDHDNPPP 149 DE + ++ ++H W +KYRPRKP + NRV+T + WNKYNQTHYD DNPPP Sbjct 526 ADESIFGAEEQLAAQRHL-WSDKYRPRKPTYLNRVQTGFDWNKYNQTHYDQDNPPP 580 > 7295594 Length=720 Score = 68.6 bits (166), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 28/35 (80%), Positives = 31/35 (88%), Gaps = 0/35 (0%) Query 115 EKYRPRKPRFFNRVRTCYFWNKYNQTHYDHDNPPP 149 +KYRPRKPR+FNRV T + WNKYNQTHYD DNPPP Sbjct 598 DKYRPRKPRYFNRVHTGFEWNKYNQTHYDMDNPPP 632 > SPBC2F12.12c Length=517 Score = 42.0 bits (97), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 0/30 (0%) Query 120 RKPRFFNRVRTCYFWNKYNQTHYDHDNPPP 149 +KP +FNRV + WN YNQ H++ +PPP Sbjct 389 KKPHYFNRVLLGFEWNSYNQAHFNEAHPPP 418 > CE19234 Length=816 Score = 36.2 bits (82), Expect = 0.022, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 5/58 (8%) Query 45 ERERRLIQLGIDKDKNEKEEEENDDEILDPAAKIVTYEDFVRKEQKNASPDEEVMADS 102 E E + + D+ +N+K+ ENDDE++ +V E F+ SP+EE++A S Sbjct 142 ESEEETVMMTTDEKENQKKPNENDDEVM-----VVDEEQFIVVSNDMKSPNEEIVAKS 194 > CE29066 Length=818 Score = 36.2 bits (82), Expect = 0.023, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 5/58 (8%) Query 45 ERERRLIQLGIDKDKNEKEEEENDDEILDPAAKIVTYEDFVRKEQKNASPDEEVMADS 102 E E + + D+ +N+K+ ENDDE++ +V E F+ SP+EE++A S Sbjct 144 ESEEETVMMTTDEKENQKKPNENDDEVM-----VVDEEQFIVVSNDMKSPNEEIVAKS 196 > Hs4757866 Length=1214 Score = 31.6 bits (70), Expect = 0.54, Method: Compositional matrix adjust. Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 6/38 (15%) Query 118 RPRKPRFFNRVRTC------YFWNKYNQTHYDHDNPPP 149 R KP + V TC Y +Y+ HYDHDNPPP Sbjct 15 RATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDNPPP 52 > Hs15295343 Length=1214 Score = 31.6 bits (70), Expect = 0.54, Method: Compositional matrix adjust. Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 6/38 (15%) Query 118 RPRKPRFFNRVRTC------YFWNKYNQTHYDHDNPPP 149 R KP + V TC Y +Y+ HYDHDNPPP Sbjct 15 RATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDNPPP 52 > Hs15147337 Length=2799 Score = 30.8 bits (68), Expect = 1.1, Method: Composition-based stats. Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 3/27 (11%) Query 44 RERERRLIQLGIDKDKNEKEEEENDDE 70 R+R R L++LGID NE E ENDD+ Sbjct 1974 RKRTRELLELGID---NEDSEHENDDD 1997 > ECU05g1530 Length=568 Score = 29.3 bits (64), Expect = 3.0, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 27/59 (45%), Gaps = 8/59 (13%) Query 63 EEEENDDEILDPAAKIVTYEDFVRKEQKNASPDEEVMADSSEMKLKQHYGWEEKYRPRK 121 +EEE D I D + + + +K +K AS DE A S W EKYRP K Sbjct 71 DEEEFDSLIKDTSKALDGTAEVEKKTEKAASRDECGSASSGV--------WSEKYRPSK 121 > At5g48600 Length=1241 Score = 28.5 bits (62), Expect = 5.1, Method: Compositional matrix adjust. Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Query 73 DPAAKIVTYEDFVRKEQKNASPDEEVMADSSEMKLKQHYGWEEKYRPRKPRFFNRVRTC 131 D AKI D ++ + N+ DE V D S +LK+ EK++ R+ N +R C Sbjct 271 DTVAKITEQRDSLQNLE-NSLKDERVKMDESNEELKKFESVHEKHKKRQEVLDNELRAC 328 > Hs17448764 Length=364 Score = 28.1 bits (61), Expect = 6.9, Method: Compositional matrix adjust. Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query 36 NERRIAKHRERERRLIQLGIDKDKNEKE-EEENDDEILDPAAKIVTYEDFVRKEQKNA 92 N+ R+ +E+ R L + KD+N E +EE+DD+I DP + + E++ +E ++A Sbjct 128 NKFRVVIFQEKFRCPTSLSVVKDRNLTENQEEDDDDIFDPPVDLSSDEEYYVEESRSA 185 Lambda K H 0.315 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1858150626 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40