bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3048_orf1 Length=175 Score E Sequences producing significant alignments: (Bits) Value CE27308 44.7 1e-04 Hs20557513 43.5 2e-04 7302300 40.0 0.002 CE20115 37.0 0.021 CE23887 37.0 0.022 At2g26910 32.0 0.66 At3g13900 30.8 1.3 At1g34260 30.4 2.1 At1g17120 30.4 2.1 At2g28070 29.6 2.9 Hs6806919 29.6 3.0 7291867 29.6 3.0 At3g09060 29.3 4.0 CE27867 29.3 4.7 CE24857 28.9 5.0 CE24856 28.9 5.0 Hs22046116 28.5 6.6 Hs13376876 28.5 6.8 Hs22042694 28.1 9.6 > CE27308 Length=156 Score = 44.7 bits (104), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 31/97 (31%), Positives = 40/97 (41%), Gaps = 5/97 (5%) Query 81 EPASLNPYRVYCEQGKVYWWCSCGKCKTQPWCDL--KNQAANGCKPLMYIPKLSGCKLLS 138 +PA RV E GK Y WCSCG TQP+CD K +P+ + + +G + Sbjct 41 QPAGTKSNRVKLEAGKTYHWCSCGLSITQPFCDGTHKTPGLTNVRPVSFQVEKTGIYPMC 100 Query 139 ASKFSEAPPFSVGSHLWVKAKLNTPRAWAAGFAFAFS 175 K + P G H V PR A AF Sbjct 101 DCKQTGTRPICDGKHADVS---KAPRDLNATRMVAFD 134 > Hs20557513 Length=127 Score = 43.5 bits (101), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 4/82 (4%) Query 86 NPYRVYCEQGKVYWWCSCGKCKTQPWCDLKN-QAANGCKPLMYIPKLSGCKLLSASKFSE 144 P +V GK Y WC CG+ K QP+CD + G PL + + + L K ++ Sbjct 45 TPIKVELVAGKTYRWCVCGRSKKQPFCDGSHFFQRTGLSPLKFKAQETRMVALCTCKATQ 104 Query 145 APPFSVGSHLWV---KAKLNTP 163 PP+ G+H KA++ +P Sbjct 105 RPPYCDGTHRSERVQKAEVGSP 126 > 7302300 Length=134 Score = 40.0 bits (92), Expect = 0.002, Method: Compositional matrix adjust. Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 3/70 (4%) Query 87 PYRVYCEQGKVYWWCSCGKCKTQPWCD--LKNQ-AANGCKPLMYIPKLSGCKLLSASKFS 143 P++++ ++ K Y WC CGK K+QP CD KN+ +P+ + + SG L K + Sbjct 55 PFKIHLDKDKTYSWCLCGKSKSQPLCDGMHKNEFLKIKQRPIRFKVEKSGDYWLCNCKQT 114 Query 144 EAPPFSVGSH 153 PF G+H Sbjct 115 THRPFCDGTH 124 > CE20115 Length=1657 Score = 37.0 bits (84), Expect = 0.021, Method: Composition-based stats. Identities = 15/30 (50%), Positives = 22/30 (73%), Gaps = 0/30 (0%) Query 37 FSFLFFLFYFILYLFYFLFILLHFISFLFF 66 F F+F L YF ++LFYF+F+L F+S + F Sbjct 1626 FFFIFLLKYFSIFLFYFIFLLNDFLSRIPF 1655 > CE23887 Length=148 Score = 37.0 bits (84), Expect = 0.022, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 4/47 (8%) Query 87 PYRVYCEQGKVYWWCSCGKCKTQPWCDLKNQAAN----GCKPLMYIP 129 P +V+ ++ KVY WCSCG +QP CD + + KP+ +IP Sbjct 85 PTKVHMKKDKVYAWCSCGYSGSQPLCDGSHNSIRIPDLKLKPVRFIP 131 > At2g26910 Length=1420 Score = 32.0 bits (71), Expect = 0.66, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Query 15 QIPPSFPFLLSFSLLFSFLLFFFSFLFFLFYFILYLFYFLFILLHFISFLFFKMVWTDWW 74 Q+ FP++L+ S ++S + F++ F + + +L+Y F+ + F F+ M+ T Sbjct 1245 QVFIEFPYVLAQSTIYSTI--FYAMAAFEWSAVKFLWYLFFMYFSIMYFTFYGMMTTAIT 1302 Query 75 PHDRV 79 P+ V Sbjct 1303 PNHNV 1307 > At3g13900 Length=1243 Score = 30.8 bits (68), Expect = 1.3, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 9/54 (16%) Query 46 FILYLFYFLFILLHFISFLFF----KMVWTDWWPHDRVPEPASL----NPYRVY 91 +I+Y + L +L+ FIS L F KM DWW + R +P L NP+ + Sbjct 304 YIIYTLFALLVLVSFISSLGFAVMTKMHMGDWW-YLRPDKPERLTNPRNPFHAW 356 > At1g34260 Length=1456 Score = 30.4 bits (67), Expect = 2.1, Method: Composition-based stats. Identities = 9/16 (56%), Positives = 13/16 (81%), Gaps = 0/16 (0%) Query 94 QGKVYWWCSCGKCKTQ 109 +GK++ W CGKCKT+ Sbjct 686 KGKIWMWSRCGKCKTK 701 > At1g17120 Length=590 Score = 30.4 bits (67), Expect = 2.1, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 4/46 (8%) Query 18 PSFPFLLSFSLLFSFLLF----FFSFLFFLFYFILYLFYFLFILLH 59 P P+L SFS+ + L + +FL F+ ++ L Y+LF+ LH Sbjct 526 PLVPWLPSFSIAMNLFLIGSLGYVAFLRFIICTMVMLLYYLFVGLH 571 > At2g28070 Length=705 Score = 29.6 bits (65), Expect = 2.9, Method: Composition-based stats. Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 7/65 (10%) Query 15 QIPPSFPFL----LSFSLLFSFLLFFFSFLFFLFYFILYLFYFLFILLHFISFLFFKMVW 70 Q S PFL +S SL+F F++ L YF+L +F+ +L++ LF +W Sbjct 510 QFLGSIPFLFLMSISSSLVFYFMVGLRDDFSLLMYFVLN--FFMCLLVNEGLMLFIACIW 567 Query 71 TD-WW 74 D +W Sbjct 568 RDVYW 572 > Hs6806919 Length=4655 Score = 29.6 bits (65), Expect = 3.0, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 16/34 (47%), Gaps = 0/34 (0%) Query 68 MVWTDWWPHDRVPEPASLNPYRVYCEQGKVYWWC 101 + W+DW H R+ + R Q K++W C Sbjct 1568 LFWSDWGHHPRIERASMDGSMRTVIVQDKIFWPC 1601 > 7291867 Length=1039 Score = 29.6 bits (65), Expect = 3.0, Method: Composition-based stats. Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 15/67 (22%) Query 22 FLLSFSLL----------FSFLLFFFSFLFFLFYFILYLFYFLFILLHF-----ISFLFF 66 FLLS L F FL + ++ + F+ IL++ + + HF I++L + Sbjct 11 FLLSICFLQVITIIERQVFDFLGYMWAPILVNFFHILFIIFGFYGAYHFRVKYIITYLIW 70 Query 67 KMVWTDW 73 +W W Sbjct 71 NFLWIGW 77 > At3g09060 Length=687 Score = 29.3 bits (64), Expect = 4.0, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 0/35 (0%) Query 114 LKNQAANGCKPLMYIPKLSGCKLLSASKFSEAPPF 148 L+ NGC+P + + C L A KF EA F Sbjct 487 LREMGKNGCRPTVVSYNILICGLCKAGKFGEASAF 521 > CE27867 Length=1704 Score = 29.3 bits (64), Expect = 4.7, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 11/49 (22%) Query 28 LLFSFLLFFFSFLFFLFYF------ILYLFYFLFI-----LLHFISFLF 65 +L+S + F F+F F++ I+ LF+FL+ ++ +SFLF Sbjct 1177 ILYSLICLIFLFMFLAFHWMYDHLAIVILFWFLYFFSSVPFIYAVSFLF 1225 > CE24857 Length=1691 Score = 28.9 bits (63), Expect = 5.0, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 11/49 (22%) Query 28 LLFSFLLFFFSFLFFLFYF------ILYLFYFLFI-----LLHFISFLF 65 +L+S + F F+F F++ I+ LF+FL+ ++ +SFLF Sbjct 1164 ILYSLICLIFLFMFLAFHWMYDHLAIVILFWFLYFFSSVPFIYAVSFLF 1212 > CE24856 Length=1689 Score = 28.9 bits (63), Expect = 5.0, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 11/49 (22%) Query 28 LLFSFLLFFFSFLFFLFYF------ILYLFYFLFI-----LLHFISFLF 65 +L+S + F F+F F++ I+ LF+FL+ ++ +SFLF Sbjct 1162 ILYSLICLIFLFMFLAFHWMYDHLAIVILFWFLYFFSSVPFIYAVSFLF 1210 > Hs22046116 Length=1059 Score = 28.5 bits (62), Expect = 6.6, Method: Composition-based stats. Identities = 9/17 (52%), Positives = 10/17 (58%), Gaps = 0/17 (0%) Query 95 GKVYWWCSCGKCKTQPW 111 G V+W CSCG C W Sbjct 115 GNVHWGCSCGLCLITTW 131 > Hs13376876 Length=148 Score = 28.5 bits (62), Expect = 6.8, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 0/48 (0%) Query 50 LFYFLFILLHFISFLFFKMVWTDWWPHDRVPEPASLNPYRVYCEQGKV 97 L+ L I+L +S +F K V +W P +P P L YR E ++ Sbjct 23 LYTVLLIVLVMMSLVFGKFVPVNWEPPQPLPFPKYLRCYRCLLETKEL 70 > Hs22042694 Length=257 Score = 28.1 bits (61), Expect = 9.6, Method: Compositional matrix adjust. Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 8/55 (14%) Query 59 HFISFLFFKMVWTDWWPHDRVPEPASLNPYRVYCEQGKVYWWCSCGKCKTQPWCD 113 H + + FK V +W P R P+ A+L G + WW T+P C+ Sbjct 160 HLVITIQFKQVRAEWMPLSRSPDKATLQ----KATPGIMGWW----DLHTRPLCE 206 Lambda K H 0.332 0.144 0.518 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2671071884 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40