bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3275_orf1 Length=130 Score E Sequences producing significant alignments: (Bits) Value At5g18790 41.2 5e-04 At3g06320 41.2 5e-04 SPBC4F6.08c 35.4 0.028 Hs4759048 29.6 1.4 Hs18585714 28.1 3.9 > At5g18790 Length=58 Score = 41.2 bits (95), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 0/47 (0%) Query 20 LLVQLKSAALSNFFYMTHKSPTKKNTRIALRKHDPRAGKHVMFYETR 66 + ++L SAA + FFY+ KS ++ RK+DPR +HV+F E + Sbjct 10 MFIRLVSAAGTGFFYVKRKSTKGLLEKLEFRKYDPRVNRHVLFTEQK 56 > At3g06320 Length=58 Score = 41.2 bits (95), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 0/47 (0%) Query 20 LLVQLKSAALSNFFYMTHKSPTKKNTRIALRKHDPRAGKHVMFYETR 66 + ++L SAA + FFY+ KS ++ RK+DPR +HV+F E + Sbjct 10 MFIRLVSAAGTGFFYVKRKSTKGLLEKLEFRKYDPRVNRHVLFTEQK 56 > SPBC4F6.08c Length=55 Score = 35.4 bits (80), Expect = 0.028, Method: Compositional matrix adjust. Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 2/48 (4%) Query 19 RLLVQLKSAALSNFFYMTHKSPTKKNTRIALRKHDPRAGKHVMFYETR 66 RLLV+L S A + FFY+ +S K ++A K+DP+ K V+F E++ Sbjct 8 RLLVKLLSTAGTGFFYV--RSRPKAAPKLAFIKYDPKIHKRVLFEESK 53 > Hs4759048 Length=65 Score = 29.6 bits (65), Expect = 1.4, Method: Compositional matrix adjust. Identities = 17/63 (26%), Positives = 36/63 (57%), Gaps = 2/63 (3%) Query 5 MFFLSPCLLRSRSKRLLVQLKSAALSNFFYMTHKSPTKKNTRIALRKHDPRAGKHVMFYE 64 MF + +S+SK +LV++ S A + F + T ++ ++ ++ L +DP + V+F E Sbjct 1 MFLSAVFFAKSKSKNILVRMVSEAGTGFCFNTKRNRLRE--KLTLLHYDPVVKQRVLFVE 58 Query 65 TRQ 67 ++ Sbjct 59 KKK 61 > Hs18585714 Length=458 Score = 28.1 bits (61), Expect = 3.9, Method: Compositional matrix adjust. Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 0/42 (0%) Query 15 SRSKRLLVQLKSAALSNFFYMTHKSPTKKNTRIALRKHDPRA 56 ++ R ++++K +S F ++ P KK R+ RK PRA Sbjct 17 AKQDRTILRIKHCGISIFKRCNNEEPVKKRERMIKRKRSPRA 58 Lambda K H 0.323 0.133 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1246445644 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40