bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3622_orf1 Length=153 Score E Sequences producing significant alignments: (Bits) Value At4g02720 54.3 8e-08 Hs13375676 48.1 6e-06 Hs20556582 47.8 9e-06 7301548 45.1 6e-05 > At4g02720 Length=420 Score = 54.3 bits (129), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 23/32 (71%), Positives = 29/32 (90%), Gaps = 0/32 (0%) Query 122 AQKNVDYGFALRPGEGEAIAQFVQEGKRIPRR 153 A+ ++ YG ALRPGEG+AIAQ+VQ+GKRIPRR Sbjct 293 AEGHISYGGALRPGEGDAIAQYVQQGKRIPRR 324 > Hs13375676 Length=415 Score = 48.1 bits (113), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 22/46 (47%), Positives = 32/46 (69%), Gaps = 0/46 (0%) Query 108 ELVGPKPMEVTNKLAQKNVDYGFALRPGEGEAIAQFVQEGKRIPRR 153 +L+GP+ + K ++YG AL PGEG A+A++V+ GKRIPRR Sbjct 289 DLIGPEAPKTLTSQDDKPLNYGHALLPGEGAAMAEYVKAGKRIPRR 334 > Hs20556582 Length=362 Score = 47.8 bits (112), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 22/46 (47%), Positives = 32/46 (69%), Gaps = 0/46 (0%) Query 108 ELVGPKPMEVTNKLAQKNVDYGFALRPGEGEAIAQFVQEGKRIPRR 153 +L+GP+ + +K + YG AL PGEG A+A++V+ GKRIPRR Sbjct 236 DLIGPEAPIIHTSQDEKPLKYGHALLPGEGAAMAEYVKAGKRIPRR 281 > 7301548 Length=463 Score = 45.1 bits (105), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 27/50 (54%), Positives = 32/50 (64%), Gaps = 3/50 (6%) Query 104 SSEDELVGPKPMEVTNKLAQKNVDYGFALRPGEGEAIAQFVQEGKRIPRR 153 S DE VGP + L QK D+G AL PGEG A+A ++ EGKRIPRR Sbjct 336 SHNDEDVGPS-LRPGGSLNQK--DFGKALLPGEGAAMAAYIAEGKRIPRR 382 Lambda K H 0.312 0.124 0.335 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1961355924 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40