bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4030_orf2 Length=198 Score E Sequences producing significant alignments: (Bits) Value CE29488 43.5 3e-04 YJL208c 42.0 8e-04 7303509 38.1 0.011 SPAC17C9.08 38.1 0.012 Hs4758270 32.7 0.48 Hs4826714_1 32.0 0.81 > CE29488 Length=308 Score = 43.5 bits (101), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 31/102 (30%), Positives = 44/102 (43%), Gaps = 31/102 (30%) Query 9 IEYEVLGHGFLPAATHFFKVLLAVSPKEAVRKERLGASPSGSHKQSQAKKDYWPYSTPPP 68 I+Y+V+G + THFFKV L TP Sbjct 221 IKYQVIGDNNVAVPTHFFKVALF-------------------------------EVTPGK 249 Query 69 AVLGAFVLPNRVIYEDVRISRFEVPLSFVELVSGIDLGVVLD 110 L +++LPN VI + V IS+F VPL VE +G+++ LD Sbjct 250 FELESYILPNAVIEDTVEISKFHVPLDAVERSAGLEIFARLD 291 > YJL208c Length=329 Score = 42.0 bits (97), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 26/100 (26%), Positives = 47/100 (47%), Gaps = 27/100 (27%) Query 7 MQIEYEVLGHG-FLPAATHFFKVLLAVSPKEAVRKERLGASPSGSHKQSQAKKDYWPYST 65 ++ YEV+G+ + THFFK+++A +P +E + Sbjct 210 FRVNYEVIGNPPSIAVPTHFFKLIVAEAPTANPAREDIA--------------------- 248 Query 66 PPPAVLGAFVLPNRVIYEDVRISRFEVPLSFVELVSGIDL 105 + AFVLPN I + +++ FEVP+ +E +G++L Sbjct 249 -----VAAFVLPNEPISNETKLTDFEVPIDALERSTGLEL 283 > 7303509 Length=310 Score = 38.1 bits (87), Expect = 0.011, Method: Compositional matrix adjust. Identities = 25/95 (26%), Positives = 40/95 (42%), Gaps = 31/95 (32%) Query 9 IEYEVLGHGFLPAATHFFKVLLAVSPKEAVRKERLGASPSGSHKQSQAKKDYWPYSTPPP 68 ++YEV+G + THF+KV++ S + E Sbjct 228 VKYEVIGANTVAVPTHFYKVIVGESADHKLHME--------------------------- 260 Query 69 AVLGAFVLPNRVIYEDVRISRFEVPLSFVELVSGI 103 ++V+PN+VI D IS F+VP VE +G+ Sbjct 261 ----SYVMPNQVISNDTPISVFQVPPESVERSAGL 291 > SPAC17C9.08 Length=335 Score = 38.1 bits (87), Expect = 0.012, Method: Compositional matrix adjust. Identities = 29/99 (29%), Positives = 46/99 (46%), Gaps = 29/99 (29%) Query 8 QIEYEVLGHG-FLPAATHFFKVLLAVSPKEAVRKERLGASPSGSHKQSQAKKDYWPYSTP 66 +++Y V+G+ + THFFKV++A E P S+P Sbjct 214 EVQYRVIGNPPNVAVPTHFFKVIIAEKSGE-------------------------PTSSP 248 Query 67 PPAVLGAFVLPNRVIYEDVRISRFEVPLSFVELVSGIDL 105 A AFVLPN+ I ++ + F VP+ VE SG+++ Sbjct 249 SVA---AFVLPNKPIADNFPLKNFAVPVEVVERASGLEI 284 > Hs4758270 Length=297 Score = 32.7 bits (73), Expect = 0.48, Method: Compositional matrix adjust. Identities = 22/95 (23%), Positives = 38/95 (40%), Gaps = 31/95 (32%) Query 9 IEYEVLGHGFLPAATHFFKVLLAVSPKEAVRKERLGASPSGSHKQSQAKKDYWPYSTPPP 68 ++Y+V+G + THFFKVL+ + + Sbjct 213 VKYQVIGKNHVAVPTHFFKVLILEAAGGQIE----------------------------- 243 Query 69 AVLGAFVLPNRVIYEDVRISRFEVPLSFVELVSGI 103 L +V+PN + E + + RF VP+ +E SG+ Sbjct 244 --LRTYVMPNAPVDEAIPLERFLVPIESIERASGL 276 > Hs4826714_1 Length=308 Score = 32.0 bits (71), Expect = 0.81, Method: Compositional matrix adjust. Identities = 24/93 (25%), Positives = 40/93 (43%), Gaps = 28/93 (30%) Query 9 IEYEVLGHGFLPAATHFFKVLLAVSPKEAVRKERLGASPSGSHKQSQAKKDYWPYSTPPP 68 + Y+V+G + +H +KV+LA + +V E P Sbjct 212 VSYQVIGEDNVAVPSHLYKVILA--RRSSVSTE--------------------------P 243 Query 69 AVLGAFVLPNRVIYEDVRISRFEVPLSFVELVS 101 LGAFV+PN I +++ F+V L +E +S Sbjct 244 LALGAFVVPNEAIGFQPQLTEFQVSLQDLEKLS 276 Lambda K H 0.320 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3407623970 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40