bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4368_orf1 Length=57 Score E Sequences producing significant alignments: (Bits) Value At5g51100 55.1 3e-08 At5g23310 48.1 3e-06 ECU11g1080 46.2 2e-05 At4g25100 45.8 2e-05 At3g10920 42.0 3e-04 SPAC1486.01 40.4 0.001 Hs10835187 38.5 0.003 At3g56350 38.5 0.003 7302882 37.4 0.007 YHR008c 37.0 0.008 CE09323 36.2 0.014 CE08002 35.4 0.024 YJL130c 29.6 1.3 At5g30623 26.9 8.1 ECU07g1060 26.9 9.7 > At5g51100 Length=305 Score = 55.1 bits (131), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%) Query 28 FELPPLPYPMDALEPYISKETLEYHYGKHH 57 FEL P PYP+DALEP++S+ETL+YH+GKHH Sbjct 53 FELKPPPYPLDALEPHMSRETLDYHWGKHH 82 > At5g23310 Length=263 Score = 48.1 bits (113), Expect = 3e-06, Method: Composition-based stats. Identities = 18/24 (75%), Positives = 22/24 (91%), Gaps = 0/24 (0%) Query 34 PYPMDALEPYISKETLEYHYGKHH 57 PYP+DALEPY+S+ TLE H+GKHH Sbjct 56 PYPLDALEPYMSRRTLEVHWGKHH 79 > ECU11g1080 Length=233 Score = 46.2 bits (108), Expect = 2e-05, Method: Composition-based stats. Identities = 19/32 (59%), Positives = 23/32 (71%), Gaps = 0/32 (0%) Query 26 MPFELPPLPYPMDALEPYISKETLEYHYGKHH 57 M F+LP L YP DALEP I +ET+ H+ KHH Sbjct 8 MEFKLPELDYPYDALEPIIDEETMRTHHSKHH 39 > At4g25100 Length=212 Score = 45.8 bits (107), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 18/28 (64%), Positives = 25/28 (89%), Gaps = 0/28 (0%) Query 30 LPPLPYPMDALEPYISKETLEYHYGKHH 57 L P P+ +DALEP++SK+TLE+H+GKHH Sbjct 13 LKPPPFALDALEPHMSKQTLEFHWGKHH 40 > At3g10920 Length=231 Score = 42.0 bits (97), Expect = 3e-04, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 0/40 (0%) Query 18 KFLELSAKMPFELPPLPYPMDALEPYISKETLEYHYGKHH 57 + L + F LP LPY ALEP IS E ++ H+ KHH Sbjct 21 RLLRIRGIQTFTLPDLPYDYGALEPAISGEIMQIHHQKHH 60 > SPAC1486.01 Length=218 Score = 40.4 bits (93), Expect = 0.001, Method: Composition-based stats. Identities = 15/28 (53%), Positives = 21/28 (75%), Gaps = 0/28 (0%) Query 30 LPPLPYPMDALEPYISKETLEYHYGKHH 57 LPPLPY +ALEP +S+ ++ H+ KHH Sbjct 28 LPPLPYAYNALEPALSETIMKLHHDKHH 55 > Hs10835187 Length=222 Score = 38.5 bits (88), Expect = 0.003, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 0/36 (0%) Query 22 LSAKMPFELPPLPYPMDALEPYISKETLEYHYGKHH 57 L ++ LP LPY ALEP+I+ + ++ H+ KHH Sbjct 20 LGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHH 55 > At3g56350 Length=241 Score = 38.5 bits (88), Expect = 0.003, Method: Compositional matrix adjust. Identities = 17/28 (60%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 30 LPPLPYPMDALEPYISKETLEYHYGKHH 57 LP LPY DALEP IS+E + H+ KHH Sbjct 38 LPDLPYAYDALEPAISEEIMRLHHQKHH 65 > 7302882 Length=217 Score = 37.4 bits (85), Expect = 0.007, Method: Compositional matrix adjust. Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 22 LSAKMPFELPPLPYPMDALEPYISKETLEYHYGKHH 57 L+ + LP LPY ALEP I +E +E H+ KHH Sbjct 13 LAVRGKHTLPKLPYDYAALEPIICREIMELHHQKHH 48 > YHR008c Length=233 Score = 37.0 bits (84), Expect = 0.008, Method: Composition-based stats. Identities = 16/28 (57%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 30 LPPLPYPMDALEPYISKETLEYHYGKHH 57 LP L + ALEPYIS + E HY KHH Sbjct 30 LPDLKWDFGALEPYISGQINELHYTKHH 57 > CE09323 Length=221 Score = 36.2 bits (82), Expect = 0.014, Method: Composition-based stats. Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 30 LPPLPYPMDALEPYISKETLEYHYGKHH 57 LP LPY LEP IS E ++ H+ KHH Sbjct 28 LPDLPYDYADLEPVISHEIMQLHHQKHH 55 > CE08002 Length=218 Score = 35.4 bits (80), Expect = 0.024, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 0/36 (0%) Query 22 LSAKMPFELPPLPYPMDALEPYISKETLEYHYGKHH 57 L+ + LP LP+ LEP IS E ++ H+ KHH Sbjct 20 LAVRSKHTLPDLPFDYADLEPVISHEIMQLHHQKHH 55 > YJL130c Length=2214 Score = 29.6 bits (65), Expect = 1.3, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Query 3 RTNSAFEFLKHTLLLKFLELSAKMPFELPPLPYPMDAL-EPYISKETLEYHY 53 R + +F F+ + + +EL+ K LP PYP++ L + Y++ + ++ + Sbjct 1265 RASRSFPFISKVVGVNLIELATKAIMGLPLTPYPVEKLPDDYVAVKVPQFSF 1316 > At5g30623 Length=302 Score = 26.9 bits (58), Expect = 8.1, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 4/47 (8%) Query 4 TNSAFEFLKHTLLLKFLELSAKMPFELP-PLPYPMDALEPYISKETL 49 T + EF+ +L+F S+ MP++LP LP PM EP I ++ L Sbjct 219 TQTEDEFIDPAGVLRFGSSSSAMPYDLPVTLPIPM---EPPIFQQYL 262 > ECU07g1060 Length=416 Score = 26.9 bits (58), Expect = 9.7, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Query 12 KHTLLLKFLELSAKMPFELPPLPYPMDALEPYISKET 48 +H LL F +L K+PF+ P L + PY K+T Sbjct 29 RHPLLCSFEDLKTKVPFDSPLL--TQKVVIPYFLKKT 63 Lambda K H 0.320 0.139 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1191047922 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40