bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4658_orf4 Length=101 Score E Sequences producing significant alignments: (Bits) Value YIL133c 62.4 2e-10 YNL069c 61.6 4e-10 SPBC839.13c 54.3 5e-08 SPAC23A1.11 54.3 5e-08 At5g48760 53.9 8e-08 Hs6912634 53.1 1e-07 At3g07110 52.8 1e-07 SPBC2G2.05 52.0 3e-07 Hs17476849 50.8 6e-07 At3g24830 50.8 6e-07 At4g13170 50.8 6e-07 Hs22052436 50.8 7e-07 7296708 48.5 3e-06 Hs22050223 47.0 9e-06 CE01030 43.1 1e-04 > YIL133c Length=199 Score = 62.4 bits (150), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 2/61 (3%) Query 16 RQQQQQQMARDAAGV--LQVYEGVPVKYERKKKVVVPQALRVVRLRPGRDFCRLGELSEL 73 R + AR A + L+V+EG+P Y++KK+VVVPQALRV+RL+PGR + LG+LS Sbjct 85 RGMVSHKTARGKAALERLKVFEGIPPPYDKKKRVVVPQALRVLRLKPGRKYTTLGKLSTS 144 Query 74 I 74 + Sbjct 145 V 145 > YNL069c Length=198 Score = 61.6 bits (148), Expect = 4e-10, Method: Compositional matrix adjust. Identities = 29/61 (47%), Positives = 43/61 (70%), Gaps = 2/61 (3%) Query 16 RQQQQQQMARDAAGV--LQVYEGVPVKYERKKKVVVPQALRVVRLRPGRDFCRLGELSEL 73 R + AR A + L+++EG+P Y++KK+VVVPQALRV+RL+PGR + LG+LS Sbjct 84 RGMVSHKTARGKAALERLKIFEGIPPPYDKKKRVVVPQALRVLRLKPGRKYTTLGKLSTS 143 Query 74 I 74 + Sbjct 144 V 144 > SPBC839.13c Length=197 Score = 54.3 bits (129), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 23/42 (54%), Positives = 33/42 (78%), Gaps = 0/42 (0%) Query 31 LQVYEGVPVKYERKKKVVVPQALRVVRLRPGRDFCRLGELSE 72 LQ EG+P ++++K+VVVP ALRV+RL+PGR +C +G LS Sbjct 103 LQAVEGIPPPFDKQKRVVVPAALRVLRLKPGRKYCTVGRLSS 144 > SPAC23A1.11 Length=197 Score = 54.3 bits (129), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 23/42 (54%), Positives = 33/42 (78%), Gaps = 0/42 (0%) Query 31 LQVYEGVPVKYERKKKVVVPQALRVVRLRPGRDFCRLGELSE 72 LQ EG+P ++++K+VVVP ALRV+RL+PGR +C +G LS Sbjct 103 LQAVEGIPPPFDKQKRVVVPAALRVLRLKPGRKYCTVGRLSS 144 > At5g48760 Length=206 Score = 53.9 bits (128), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 25/54 (46%), Positives = 37/54 (68%), Gaps = 2/54 (3%) Query 21 QQMARDAAGV--LQVYEGVPVKYERKKKVVVPQALRVVRLRPGRDFCRLGELSE 72 + R AA + L+VYEGVP Y++ K++V+P AL+V+RL+ G +C LG LS Sbjct 95 HKTKRGAAALARLKVYEGVPTPYDKIKRMVIPDALKVLRLQAGHKYCLLGRLSS 148 > Hs6912634 Length=203 Score = 53.1 bits (126), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 22/42 (52%), Positives = 33/42 (78%), Gaps = 0/42 (0%) Query 31 LQVYEGVPVKYERKKKVVVPQALRVVRLRPGRDFCRLGELSE 72 L+V++G+P Y++KK++VVP AL+VVRL+P R F LG L+ Sbjct 102 LKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAH 143 > At3g07110 Length=206 Score = 52.8 bits (125), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 23/47 (48%), Positives = 34/47 (72%), Gaps = 0/47 (0%) Query 26 DAAGVLQVYEGVPVKYERKKKVVVPQALRVVRLRPGRDFCRLGELSE 72 +A L+V+EGVP Y++ K++VVP AL+V+RL+ G +C LG LS Sbjct 102 NALARLKVFEGVPTPYDKIKRMVVPDALKVLRLQAGHKYCLLGRLSS 148 > SPBC2G2.05 Length=197 Score = 52.0 bits (123), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 21/42 (50%), Positives = 32/42 (76%), Gaps = 0/42 (0%) Query 31 LQVYEGVPVKYERKKKVVVPQALRVVRLRPGRDFCRLGELSE 72 LQ EG+P ++++K++VVP ALRV+RL+P R +C +G LS Sbjct 103 LQALEGIPPPFDKQKRLVVPAALRVLRLKPSRKYCTIGRLSS 144 > Hs17476849 Length=359 Score = 50.8 bits (120), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 21/38 (55%), Positives = 31/38 (81%), Gaps = 0/38 (0%) Query 31 LQVYEGVPVKYERKKKVVVPQALRVVRLRPGRDFCRLG 68 L+V++G+P Y++KK++VVP AL+VVRL+P R F LG Sbjct 268 LKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFALLG 305 > At3g24830 Length=206 Score = 50.8 bits (120), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 24/54 (44%), Positives = 37/54 (68%), Gaps = 2/54 (3%) Query 21 QQMARDAAGV--LQVYEGVPVKYERKKKVVVPQALRVVRLRPGRDFCRLGELSE 72 + R AA + L+V+EGVP Y++ K++V+P AL+V+RL+ G +C LG LS Sbjct 95 HKTKRGAAALARLKVFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSS 148 > At4g13170 Length=206 Score = 50.8 bits (120), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 23/54 (42%), Positives = 37/54 (68%), Gaps = 2/54 (3%) Query 21 QQMARDAAGV--LQVYEGVPVKYERKKKVVVPQALRVVRLRPGRDFCRLGELSE 72 + R AA + L+V+EG+P Y++ K++V+P AL+V+RL+ G +C LG LS Sbjct 95 HKTKRGAAALARLKVFEGIPPPYDKIKRMVIPDALKVLRLQSGHKYCLLGRLSS 148 > Hs22052436 Length=203 Score = 50.8 bits (120), Expect = 7e-07, Method: Compositional matrix adjust. Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 0/42 (0%) Query 31 LQVYEGVPVKYERKKKVVVPQALRVVRLRPGRDFCRLGELSE 72 L+V +G+P Y++KK++VVP AL+VVRL+P R F LG L+ Sbjct 102 LKVSDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAH 143 > 7296708 Length=205 Score = 48.5 bits (114), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 19/42 (45%), Positives = 33/42 (78%), Gaps = 0/42 (0%) Query 31 LQVYEGVPVKYERKKKVVVPQALRVVRLRPGRDFCRLGELSE 72 L+V++G+P Y+++++VVVP A+RV+ LR R +C++G LS Sbjct 104 LRVFDGIPSPYDKRRRVVVPIAMRVLTLRSDRKYCQVGRLSH 145 > Hs22050223 Length=154 Score = 47.0 bits (110), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 0/58 (0%) Query 15 RRQQQQQQMARDAAGVLQVYEGVPVKYERKKKVVVPQALRVVRLRPGRDFCRLGELSE 72 R Q Q + + L+V++G P Y++KK++++P AL+V+RL+ R F LG L+ Sbjct 37 RHAASQDQGGQASLDCLKVFDGTPPPYDKKKQMMIPAALKVMRLKLTRKFVYLGHLAH 94 > CE01030 Length=202 Score = 43.1 bits (100), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Query 19 QQQQMARDAAGVLQVYEGVPVKYERKKKVVVPQALRVVRLRPGRDFCRLGELSE 72 + +A L+ YEGVP KY++ K + P A R RL+P R FC +G LS Sbjct 91 HKTNRGNEALKNLRAYEGVPAKYQKTKSLHAPSASR-FRLQPRRKFCVVGRLSH 143 Lambda K H 0.322 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1184494980 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40