bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4938_orf1 Length=106 Score E Sequences producing significant alignments: (Bits) Value 7290846 39.3 0.002 Hs17158044 38.5 0.003 YPL090c 38.1 0.004 YBR181c 38.1 0.004 At4g31700 37.7 0.005 Hs18579097 37.7 0.005 At5g10360 37.4 0.006 SPAPB1E7.12 36.2 0.014 SPAC13G6.07c 36.2 0.016 CE24592 33.1 0.13 ECU05g0670 32.0 0.27 Hs17448285_2 30.4 0.79 Hs18591779 29.6 1.5 At1g73880 27.3 6.5 CE25868 27.3 6.7 > 7290846 Length=217 Score = 39.3 bits (90), Expect = 0.002, Method: Compositional matrix adjust. Identities = 16/29 (55%), Positives = 20/29 (68%), Gaps = 0/29 (0%) Query 63 GRIFKGYHFRITGGFYKQGFPVMVGILSH 91 G +KGY RI GG KQGFP+ G+L+H Sbjct 11 GDEWKGYQLRIAGGNDKQGFPMKQGVLTH 39 > Hs17158044 Length=249 Score = 38.5 bits (88), Expect = 0.003, Method: Compositional matrix adjust. Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 0/29 (0%) Query 63 GRIFKGYHFRITGGFYKQGFPVMVGILSH 91 G +KGY RI+GG KQGFP+ G+L+H Sbjct 42 GEEWKGYVVRISGGNDKQGFPMKQGVLTH 70 > YPL090c Length=236 Score = 38.1 bits (87), Expect = 0.004, Method: Compositional matrix adjust. Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query 31 GSRSLWRSTDAERICCLSLNYTWGRRSLETLSGRIFKGYHFRITGGFYKQGFPVMVGIL 89 GS+ + D RI + G+ G FKGY F+I+GG KQGFP+ G+L Sbjct 11 GSQKTFEIDDEHRIRVF-FDKRIGQEVDGEAVGDEFKGYVFKISGGNDKQGFPMKQGVL 68 > YBR181c Length=236 Score = 38.1 bits (87), Expect = 0.004, Method: Compositional matrix adjust. Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query 31 GSRSLWRSTDAERICCLSLNYTWGRRSLETLSGRIFKGYHFRITGGFYKQGFPVMVGIL 89 GS+ + D RI + G+ G FKGY F+I+GG KQGFP+ G+L Sbjct 11 GSQKTFEIDDEHRIRVF-FDKRIGQEVDGEAVGDEFKGYVFKISGGNDKQGFPMKQGVL 68 > At4g31700 Length=250 Score = 37.7 bits (86), Expect = 0.005, Method: Compositional matrix adjust. Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 63 GRIFKGYHFRITGGFYKQGFPVMVGILS 90 G FKGY F+I GG KQGFP+ G+L+ Sbjct 42 GEEFKGYVFKIKGGCDKQGFPMKQGVLT 69 > Hs18579097 Length=240 Score = 37.7 bits (86), Expect = 0.005, Method: Compositional matrix adjust. Identities = 17/31 (54%), Positives = 22/31 (70%), Gaps = 0/31 (0%) Query 63 GRIFKGYHFRITGGFYKQGFPVMVGILSHRR 93 G +KGY RI+GG KQGFP+ G+L+H R Sbjct 42 GEEWKGYVVRISGGNNKQGFPMKQGVLTHGR 72 > At5g10360 Length=249 Score = 37.4 bits (85), Expect = 0.006, Method: Compositional matrix adjust. Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 63 GRIFKGYHFRITGGFYKQGFPVMVGILS 90 G FKGY F+I GG KQGFP+ G+L+ Sbjct 42 GEEFKGYVFKIMGGCDKQGFPMKQGVLT 69 > SPAPB1E7.12 Length=239 Score = 36.2 bits (82), Expect = 0.014, Method: Compositional matrix adjust. Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 2/63 (3%) Query 31 GSRSLWRSTDAERICCLSLNYTWGRRSLETLSGRIFKGYHFRITGGFYKQGFPVMVGI-L 89 G++ L D R+ + G+ G F GY F+ITGG KQGFP+ G+ L Sbjct 11 GTQKLIEIDDDRRLRVF-MEKRMGQEVPGDSVGPEFAGYVFKITGGNDKQGFPMFQGVLL 69 Query 90 SHR 92 HR Sbjct 70 PHR 72 > SPAC13G6.07c Length=239 Score = 36.2 bits (82), Expect = 0.016, Method: Compositional matrix adjust. Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 2/63 (3%) Query 31 GSRSLWRSTDAERICCLSLNYTWGRRSLETLSGRIFKGYHFRITGGFYKQGFPVMVGI-L 89 G++ L D R+ + G+ G F GY F+ITGG KQGFP+ G+ L Sbjct 11 GTQKLIEIDDDRRLRVF-MEKRMGQEVPGDSVGPEFAGYVFKITGGNDKQGFPMFQGVLL 69 Query 90 SHR 92 HR Sbjct 70 PHR 72 > CE24592 Length=246 Score = 33.1 bits (74), Expect = 0.13, Method: Compositional matrix adjust. Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 0/32 (0%) Query 63 GRIFKGYHFRITGGFYKQGFPVMVGILSHRRC 94 G +KGY RI GG KQGFP+ GIL++ R Sbjct 42 GDEWKGYVVRIGGGNDKQGFPMKQGILTNGRV 73 > ECU05g0670 Length=203 Score = 32.0 bits (71), Expect = 0.27, Method: Compositional matrix adjust. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 0/34 (0%) Query 63 GRIFKGYHFRITGGFYKQGFPVMVGILSHRRCSP 96 G F+G ITGG QGFP++ G L+ +R P Sbjct 27 GEEFEGTIMEITGGDDYQGFPMVSGHLTKKRVRP 60 > Hs17448285_2 Length=155 Score = 30.4 bits (67), Expect = 0.79, Method: Compositional matrix adjust. Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query 31 GSRSLWRSTDAERICCLSLNYTWGRRSLETLSGRIFKGYHFRITGGFYKQGFPVMVGILS 90 G + L D ++C + + + L +KGY I+GG KQ FP+ G+L Sbjct 3 GCQKLIEVDDKRKLCTFYEKHMATEVAADALVEE-WKGYVVLISGGNDKQWFPMKRGVLI 61 Query 91 HRR 93 H R Sbjct 62 HGR 64 > Hs18591779 Length=615 Score = 29.6 bits (65), Expect = 1.5, Method: Composition-based stats. Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 10/69 (14%) Query 40 DAERICCLSLNYTW-----GRRSLETLSGRIFKGY--HFRITGGFYKQGFPVMVGILSHR 92 D R+ S ++TW +L LSG++ + + FRI Y Q P+ +LSH Sbjct 279 DGIRVATGSYSFTWTDGKLNSSNLVILSGQVVEHFDLEFRI---LYAQSKPISPKLLSHF 335 Query 93 RCSPRVPHL 101 + S + HL Sbjct 336 QSSNKFDHL 344 > At1g73880 Length=570 Score = 27.3 bits (59), Expect = 6.5, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Query 59 ETLSGRIFKGYHFRITG-GFYKQGFPVMVGILSHRRCSPRVPHLGMN 104 ++ G I G+ R+ G G +G+ V +L HR + H G N Sbjct 323 DSTRGNILDGFDDRVAGRGLVIRGWAPQVAVLRHRAVGAFLTHCGWN 369 > CE25868 Length=317 Score = 27.3 bits (59), Expect = 6.7, Method: Compositional matrix adjust. Identities = 10/35 (28%), Positives = 18/35 (51%), Gaps = 0/35 (0%) Query 34 SLWRSTDAERICCLSLNYTWGRRSLETLSGRIFKG 68 ++W S I CL++ + W R + L+ R+ G Sbjct 95 AVWTSLLISEIVCLTICFAWKHRKISKLANRLNDG 129 Lambda K H 0.328 0.143 0.474 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1167556980 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40