bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5607_orf3 Length=55 Score E Sequences producing significant alignments: (Bits) Value At3g55270 42.4 2e-04 Hs4758204 36.6 0.011 Hs4503417 36.2 0.017 At3g23610 35.8 0.020 Hs16950652 35.4 0.029 7293827 33.9 0.068 Hs12707566 33.5 0.097 At3g06110 33.1 0.14 Hs15306857 33.1 0.15 Hs4503419 32.7 0.15 Hs22045871 32.7 0.17 Hs12707568 32.7 0.18 Hs21536331 32.0 0.28 Hs20149631 32.0 0.30 7293616 30.8 0.58 Hs6005812 30.8 0.59 Hs4758206 30.4 0.77 Hs4503421 30.0 1.0 Hs13128968 30.0 1.1 CE18519 29.3 1.7 CE07918 29.3 1.9 Hs6005956 28.9 2.2 7294466 28.5 3.3 7298988 28.1 3.7 Hs5902002 28.1 3.8 > At3g55270 Length=771 Score = 42.4 bits (98), Expect = 2e-04, Method: Composition-based stats. Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 0/44 (0%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQKRLGLKP 44 LMW+ F +AF+ ++S R I PN GF QLL QKR+ P Sbjct 198 LMWREGQSFDDAFQYVKSARGIADPNMGFACQLLQCQKRVHAFP 241 > Hs4758204 Length=367 Score = 36.6 bits (83), Expect = 0.011, Method: Compositional matrix adjust. Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQKRLGLKPHRAA 48 LM R+ EAFE ++ RR+I SPN F QLL + ++ L PH +A Sbjct 273 LMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQV-LAPHCSA 319 > Hs4503417 Length=394 Score = 36.2 bits (82), Expect = 0.017, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 0/40 (0%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQKRL 40 LM K R+ EAFE ++ RR+I SPN F QLL + ++ Sbjct 295 LMMKKRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQV 334 > At3g23610 Length=198 Score = 35.8 bits (81), Expect = 0.020, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 25/40 (62%), Gaps = 0/40 (0%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQKRL 40 LM K + A+A + ++S+R + SPN GF QL L+K + Sbjct 150 LMKKHGMTLAQALQHVKSKRPVASPNAGFIRQLQDLEKSM 189 > Hs16950652 Length=303 Score = 35.4 bits (80), Expect = 0.029, Method: Compositional matrix adjust. Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 0/40 (0%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQKRL 40 LM K R+ EAFE ++ RR+I SPN F QLL + ++ Sbjct 204 LMMKKRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQV 243 > 7293827 Length=348 Score = 33.9 bits (76), Expect = 0.068, Method: Composition-based stats. Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQKRLGLKPHRAAFSC 51 LM L +AF +R R+ SPN F QLL + +L L+P + FSC Sbjct 191 LMHTRGLSLNDAFAMVRDRKPDVSPNFHFMQQLLSFESQLRLRPG-SRFSC 240 > Hs12707566 Length=384 Score = 33.5 bits (75), Expect = 0.097, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQKR-LGLKPHRAAFSCRNQA 55 LM + EAF+ ++ RR++ SPN GF QLL + L P+ SC+ +A Sbjct 278 LMKTKQFRLKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEA 333 > At3g06110 Length=167 Score = 33.1 bits (74), Expect = 0.14, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 0/40 (0%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQKRL 40 LM K + F++A E +RSRR PN GF QL +K + Sbjct 124 LMKKHGMGFSKAMELVRSRRHQAYPNPGFISQLQQFEKSI 163 > Hs15306857 Length=381 Score = 33.1 bits (74), Expect = 0.15, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 0/42 (0%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQKRLGL 42 LM KL L +A++ ++ +++ SPN F QLL ++ LGL Sbjct 308 LMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGL 349 > Hs4503419 Length=381 Score = 32.7 bits (73), Expect = 0.15, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 0/42 (0%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQKRLGL 42 LM KL L +A++ ++ +++ SPN F QLL ++ LGL Sbjct 308 LMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGL 349 > Hs22045871 Length=320 Score = 32.7 bits (73), Expect = 0.17, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 5/55 (9%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQKRLGLKPHRAAFSCRNQA 55 LM K+ L +A++ ++ +++ SPN F QLL ++ LGL C N A Sbjct 247 LMQKMNLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTLGLSS-----PCDNHA 296 > Hs12707568 Length=235 Score = 32.7 bits (73), Expect = 0.18, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 0/42 (0%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQKRLGL 42 LM KL L +A++ ++ +++ SPN F QLL ++ LGL Sbjct 162 LMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGL 203 > Hs21536331 Length=140 Score = 32.0 bits (71), Expect = 0.28, Method: Compositional matrix adjust. Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQKRL--GLKP 44 LM R+ +A++ ++ +R I SPN F QLL ++ L G+ P Sbjct 81 LMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTP 126 > Hs20149631 Length=198 Score = 32.0 bits (71), Expect = 0.30, Method: Composition-based stats. Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQKRLGLKPHR 46 LM + EA + +++ R IC PN+GF QL +L RLG + R Sbjct 153 LMIYENMTLVEAIQTVQAHRNIC-PNSGFLRQLQVLDNRLGRETGR 197 > 7293616 Length=387 Score = 30.8 bits (68), Expect = 0.58, Method: Compositional matrix adjust. Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQKRLGLK 43 +M + L F A+E ++++R PN GF QL L +R+G K Sbjct 141 MMKRHNLDFLPAYELVKAKRRFVQPNAGFVSQLKLF-RRMGCK 182 > Hs6005812 Length=482 Score = 30.8 bits (68), Expect = 0.59, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQKRL--GLKP 44 LM R+ +A++ ++ +R I SPN F QLL ++ L G+ P Sbjct 423 LMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTP 468 > Hs4758206 Length=314 Score = 30.4 bits (67), Expect = 0.77, Method: Compositional matrix adjust. Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 0/40 (0%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQKRL 40 LM R+ EAF+ ++ RR + SPN F QLL + ++ Sbjct 272 LMQSRRVRLDEAFDFVKQRRGVISPNFSFMGQLLQFETQV 311 > Hs4503421 Length=384 Score = 30.0 bits (66), Expect = 1.0, Method: Compositional matrix adjust. Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 0/43 (0%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQKRLGLK 43 LM KL L +A++ ++ +++ SPN F QLL ++ L L+ Sbjct 305 LMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLRLE 347 > Hs13128968 Length=211 Score = 30.0 bits (66), Expect = 1.1, Method: Compositional matrix adjust. Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQKRL 40 LM L EA ++++ R I PN GF QLL L +RL Sbjct 167 LMLYHHLTLVEAIKKVKDHRGII-PNRGFLRQLLALDRRL 205 > CE18519 Length=272 Score = 29.3 bits (64), Expect = 1.7, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 0/38 (0%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQK 38 LM+K + P +A + + S R PN GF QL + ++ Sbjct 107 LMYKNQWPVEKALKMIESVRKTIGPNAGFLAQLKIWER 144 > CE07918 Length=365 Score = 29.3 bits (64), Expect = 1.9, Method: Compositional matrix adjust. Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 0/39 (0%) Query 12 AFERLRSRRAICSPNTGFTFQLLLLQKRLGLKPHRAAFS 50 A+E ++ R A +PN F QL +K LGL +R S Sbjct 293 AYEWVQKRNASIAPNFHFMGQLTDYEKMLGLNSNRVGVS 331 > Hs6005956 Length=340 Score = 28.9 bits (63), Expect = 2.2, Method: Compositional matrix adjust. Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 0/37 (0%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQLLLLQ 37 LM +LPF +A+E+L+ + N GF +QL L Q Sbjct 130 LMKTDQLPFEKAYEKLQILKPEAKMNEGFEWQLKLYQ 166 > 7294466 Length=608 Score = 28.5 bits (62), Expect = 3.3, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 0/33 (0%) Query 1 LMWKLRLPFAEAFERLRSRRAICSPNTGFTFQL 33 +M L + EA + +R+ RA+ +PN GF QL Sbjct 123 IMTATHLNWKEALKVVRAGRAVANPNAGFQSQL 155 > 7298988 Length=476 Score = 28.1 bits (61), Expect = 3.7, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 0/34 (0%) Query 7 LPFAEAFERLRSRRAICSPNTGFTFQLLLLQKRL 40 L EA++ ++ R I SPN F QLL L++ L Sbjct 237 LSLLEAYKLVKVARPIISPNLNFMGQLLELEQNL 270 > Hs5902002 Length=198 Score = 28.1 bits (61), Expect = 3.8, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 20/30 (66%), Gaps = 0/30 (0%) Query 11 EAFERLRSRRAICSPNTGFTFQLLLLQKRL 40 EA+ +++RR + PN GF QL+ +++L Sbjct 136 EAYNWVKARRPVIRPNVGFWRQLIDYERQL 165 Lambda K H 0.333 0.140 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1197145602 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40