bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6139_orf1 Length=80 Score E Sequences producing significant alignments: (Bits) Value YHR128w 37.4 0.006 At1g55810 34.7 0.039 SPAC1B3.01c 34.3 0.053 SPAC1002.17c 33.1 0.12 SPAC1399.04c 33.1 0.13 At3g53900 33.1 0.14 At4g26510 32.3 0.19 7302796 30.8 0.59 Hs8923487 28.9 2.6 At3g27440 28.5 3.1 Hs22043058 28.1 3.7 At3g27190 28.1 4.0 Hs5803171 28.1 4.4 At4g16120 27.7 6.0 > YHR128w Length=251 Score = 37.4 bits (85), Expect = 0.006, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%) Query 22 SIEAGLNDKNFLVPGIGDFGDRSCC 46 +++ GL++ +LVPG+GDFGDR C Sbjct 226 ALDRGLDENKYLVPGLGDFGDRYYC 250 > At1g55810 Length=466 Score = 34.7 bits (78), Expect = 0.039, Method: Composition-based stats. Identities = 14/21 (66%), Positives = 18/21 (85%), Gaps = 0/21 (0%) Query 23 IEAGLNDKNFLVPGIGDFGDR 43 IE GLND+ +VPG+G+FGDR Sbjct 439 IELGLNDEFRVVPGMGEFGDR 459 > SPAC1B3.01c Length=219 Score = 34.3 bits (77), Expect = 0.053, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 18/25 (72%), Gaps = 0/25 (0%) Query 18 VFCCSIEAGLNDKNFLVPGIGDFGD 42 + I+ GL++ ++VPG+GDFGD Sbjct 188 IVTAVIDEGLDNNGYIVPGLGDFGD 212 > SPAC1002.17c Length=189 Score = 33.1 bits (74), Expect = 0.12, Method: Compositional matrix adjust. Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 0/21 (0%) Query 23 IEAGLNDKNFLVPGIGDFGDR 43 ++ L+ K +LVPG+GD GDR Sbjct 163 VDKSLDAKGYLVPGVGDIGDR 183 > SPAC1399.04c Length=220 Score = 33.1 bits (74), Expect = 0.13, Method: Compositional matrix adjust. Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 0/29 (0%) Query 20 CCSIEAGLNDKNFLVPGIGDFGDRSCCCC 48 SI+ LN ++VPG GDFGDR C Sbjct 192 TASIDPELNANKYVVPGCGDFGDRYFGTC 220 > At3g53900 Length=296 Score = 33.1 bits (74), Expect = 0.14, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 20/27 (74%), Gaps = 0/27 (0%) Query 18 VFCCSIEAGLNDKNFLVPGIGDFGDRS 44 V+ I+ +N+K +++PG+GD GDRS Sbjct 261 VYAGIIDPEVNEKGYIIPGLGDAGDRS 287 > At4g26510 Length=198 Score = 32.3 bits (72), Expect = 0.19, Method: Compositional matrix adjust. Identities = 11/26 (42%), Positives = 19/26 (73%), Gaps = 0/26 (0%) Query 18 VFCCSIEAGLNDKNFLVPGIGDFGDR 43 + I+ GLN++ ++PG+G+FGDR Sbjct 166 IVTSEIDNGLNEEFRVIPGMGEFGDR 191 > 7302796 Length=614 Score = 30.8 bits (68), Expect = 0.59, Method: Composition-based stats. Identities = 10/22 (45%), Positives = 18/22 (81%), Gaps = 0/22 (0%) Query 22 SIEAGLNDKNFLVPGIGDFGDR 43 +++ +N K +++PGIG+FGDR Sbjct 583 ALDPEINSKFYVIPGIGNFGDR 604 > Hs8923487 Length=548 Score = 28.9 bits (63), Expect = 2.6, Method: Composition-based stats. Identities = 10/26 (38%), Positives = 18/26 (69%), Gaps = 0/26 (0%) Query 18 VFCCSIEAGLNDKNFLVPGIGDFGDR 43 + +++ +ND ++PGIG+FGDR Sbjct 503 IITTAVDKRVNDLFRIIPGIGNFGDR 528 > At3g27440 Length=465 Score = 28.5 bits (62), Expect = 3.1, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 17/21 (80%), Gaps = 0/21 (0%) Query 23 IEAGLNDKNFLVPGIGDFGDR 43 I++ LN+ + ++PG+G+F DR Sbjct 423 IDSSLNEDSRVIPGLGEFADR 443 > Hs22043058 Length=3631 Score = 28.1 bits (61), Expect = 3.7, Method: Composition-based stats. Identities = 7/16 (43%), Positives = 11/16 (68%), Gaps = 0/16 (0%) Query 37 IGDFGDRSCCCCSCSC 52 +G+ +R+CCC C C Sbjct 2306 LGNIAERTCCCTFCKC 2321 > At3g27190 Length=483 Score = 28.1 bits (61), Expect = 4.0, Method: Composition-based stats. Identities = 10/21 (47%), Positives = 17/21 (80%), Gaps = 0/21 (0%) Query 23 IEAGLNDKNFLVPGIGDFGDR 43 I+ LN++ ++PG+G+FGDR Sbjct 457 IDQCLNEEFRVIPGLGEFGDR 477 > Hs5803171 Length=276 Score = 28.1 bits (61), Expect = 4.4, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 0/34 (0%) Query 46 CCCSCSCCCSYSAAAAAVAAAAAPVARAVCQVLW 79 CC + C + S AA AV A+++PV V W Sbjct 168 CCVLTTPCLTQSTAAPAVRASSSPVTLRQKTVDW 201 > At4g16120 Length=661 Score = 27.7 bits (60), Expect = 6.0, Method: Composition-based stats. Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 0/28 (0%) Query 40 FGDRSCCCCSCSCCCSYSAAAAAVAAAA 67 F D C +C+C CS + AA A +A A Sbjct 429 FNDSIVPCKTCACGCSSNKAARACSATA 456 Lambda K H 0.334 0.138 0.508 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1165602088 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40