bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6392_orf3 Length=61 Score E Sequences producing significant alignments: (Bits) Value SPAC19G12.08 45.4 2e-05 YMR272c_2 38.9 0.002 7304220 33.1 0.12 At4g20870 31.6 0.42 At2g34770 31.2 0.53 Hs13236538 29.3 1.7 CE08370_2 28.5 3.3 > SPAC19G12.08 Length=347 Score = 45.4 bits (106), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 8/58 (13%) Query 8 LEPLTKTRWWQVLLLWGP--VCGYLAYCSFKTHPLPWSVGMLFF--GLFVWTFVEYCM 61 LEPLTKT W+ + L+W P G+L C+ +P+SV + FF GLF WT VEY M Sbjct 150 LEPLTKTPWYMIPLIWVPCVTYGFLYACT----GIPFSVAITFFIIGLFTWTLVEYTM 203 > YMR272c_2 Length=237 Score = 38.9 bits (89), Expect = 0.002, Method: Compositional matrix adjust. Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 0/54 (0%) Query 8 LEPLTKTRWWQVLLLWGPVCGYLAYCSFKTHPLPWSVGMLFFGLFVWTFVEYCM 61 LEPLTKT WW V + W PV Y + K ++ + G+FVWT +EY + Sbjct 43 LEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGL 96 > 7304220 Length=230 Score = 33.1 bits (74), Expect = 0.12, Method: Compositional matrix adjust. Identities = 25/63 (39%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Query 4 PWPQLEPLTKTRWWQVLLLWGPVCGYLAYCSFKT-----HPLPWSVGMLFFGLFVWTFVE 58 PW LE TKT WW V L W PV A F T + L G FG+ +W+F+E Sbjct 29 PW-YLEMCTKTPWWLVPLFWIPVIVKCAVEEFTTAWQDSNQLAVFSGYFLFGVLLWSFLE 87 Query 59 YCM 61 Y + Sbjct 88 YTL 90 > At4g20870 Length=237 Score = 31.6 bits (70), Expect = 0.42, Method: Compositional matrix adjust. Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query 9 EPLTKTRWWQVLLLWGP-VCGYLAYCSFKTHPLPWSVGMLFFGLFVWTFVEYCM 61 E LT+T WW + +W P VC L+ + K P ++ FG+ WT +EY + Sbjct 48 EFLTRTVWWAIPTIWLPVVCYVLSISASKGLTFPQIGLIVAFGVLTWTLLEYTL 101 > At2g34770 Length=237 Score = 31.2 bits (69), Expect = 0.53, Method: Compositional matrix adjust. Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query 9 EPLTKTRWWQVLLLWGPVCGYLAYCSFKTH-PLPWSVGMLFFGLFVWTFVEYCM 61 E LT T WW V ++W PV + S LP V ++ G+F+WTF EY + Sbjct 48 EFLTLTVWWAVPVIWLPVVVWCISRSVSMGCSLPEIVPIVVMGIFIWTFFEYVL 101 > Hs13236538 Length=280 Score = 29.3 bits (64), Expect = 1.7, Method: Compositional matrix adjust. Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 19/73 (26%) Query 8 LEPLTKTRWWQVLLLWGPVCGYLA--------------YCSFKTH---PLPWSV--GMLF 48 +E L+KT W+ V ++W P+ YL+ + SF T +P S+ G+ Sbjct 69 IEGLSKTVWYSVPIIWVPLVLYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFM 128 Query 49 FGLFVWTFVEYCM 61 G F+W+ +EY + Sbjct 129 LGTFLWSLIEYLI 141 > CE08370_2 Length=227 Score = 28.5 bits (62), Expect = 3.3, Method: Compositional matrix adjust. Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 8/62 (12%) Query 8 LEPLTKTRWWQVLLLWGPVC---GYLAYCSFKTHPLPWSVGML-----FFGLFVWTFVEY 59 LE +T+T WW V +W P+ L+ SF T ++ +L G+ WT EY Sbjct 32 LESMTRTAWWVVPAVWMPIVITFSILSVLSFSTSTDVYNSILLWSAWFVIGVLTWTLTEY 91 Query 60 CM 61 + Sbjct 92 SL 93 Lambda K H 0.332 0.147 0.600 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1178852562 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40