bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6468_orf1 Length=72 Score E Sequences producing significant alignments: (Bits) Value CE13273 33.5 0.10 Hs17438952 33.1 0.14 At3g03770 31.6 0.42 Hs18597149 30.4 0.75 At5g22320 30.0 1.1 At1g33600 29.6 1.3 7291344 29.6 1.6 7301474 28.9 2.5 Hs13027616 28.9 2.6 Hs21361633 28.1 3.6 7304111 28.1 3.7 Hs18141297 28.1 4.1 7300250 28.1 4.1 At4g26540 27.7 4.8 7294497 27.7 5.1 ECU09g0460 27.7 5.5 Hs15529980 27.7 6.2 7296315 27.7 6.2 CE02013_1 27.3 6.4 CE00526 27.3 6.5 7294300 27.3 6.5 At4g35470 27.3 6.6 7297490 27.3 7.5 Hs16751843 26.9 8.1 CE24708 26.9 8.5 CE24709 26.9 8.5 Hs21389483_1 26.9 9.6 YOR373w 26.9 9.7 > CE13273 Length=1152 Score = 33.5 bits (75), Expect = 0.10, Method: Compositional matrix adjust. Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 4/52 (7%) Query 1 DNKLTSLYPVRLAANLVYLNASNNQIRSAAELSANAK---LEHVDLRRNLIT 49 +NKLT+L P+ NLV L+ SNN++ S A L + LE++D R N +T Sbjct 983 NNKLTTLTPLS-CPNLVSLDISNNKLASCASLKPLCECKTLENLDCRNNSVT 1033 > Hs17438952 Length=294 Score = 33.1 bits (74), Expect = 0.14, Method: Composition-based stats. Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Query 14 ANLVYLNASNNQIRSAAE--LSANAKLEHVDLRRNLITSLG 52 +LVYL+ NN +RS E S +AKL +DL N +T LG Sbjct 80 GDLVYLDFRNNSLRSLEEGTFSGSAKLVFLDLSYNNLTQLG 120 > At3g03770 Length=803 Score = 31.6 bits (70), Expect = 0.42, Method: Compositional matrix adjust. Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 4/52 (7%) Query 2 NKLTSLYPVRLAA--NLVYLNASNNQI--RSAAELSANAKLEHVDLRRNLIT 49 N +P L + + YLN S+N++ R +A LS N++L VD+ NL+T Sbjct 280 NTFVGPFPTSLMSLPAITYLNISHNKLTGRLSANLSCNSQLMFVDMSSNLLT 331 Score = 30.0 bits (66), Expect = 1.00, Method: Compositional matrix adjust. Identities = 24/63 (38%), Positives = 35/63 (55%), Gaps = 6/63 (9%) Query 2 NKLTSLYPVRLAANLVYLNASNNQIRSAA---ELSANAKLEHVDLRRNLITSLGDILSYL 58 N L+P RL+ LV L S N+ RSA E+S+ +L+H+DL N T +G + L Sbjct 234 NSFGPLFP-RLSNKLVTLILSKNKFRSAVSAEEVSSLYQLQHLDLSYN--TFVGPFPTSL 290 Query 59 TTL 61 +L Sbjct 291 MSL 293 > Hs18597149 Length=987 Score = 30.4 bits (67), Expect = 0.75, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 0/57 (0%) Query 2 NKLTSLYPVRLAANLVYLNASNNQIRSAAELSANAKLEHVDLRRNLITSLGDILSYL 58 N+ T L V NL YL+AS+N + + KL+H+DL N + G+ ++ L Sbjct 514 NEFTCLDDVYHLYNLEYLDASHNHVITLEGFRGLMKLKHLDLSWNQLKKSGNEINML 570 > At5g22320 Length=452 Score = 30.0 bits (66), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 0/62 (0%) Query 2 NKLTSLYPVRLAANLVYLNASNNQIRSAAELSANAKLEHVDLRRNLITSLGDILSYLTTL 61 NKL S+ + NL L ++N+I S +L L + L RN I+ +GD LS L L Sbjct 95 NKLKSMNEISSLVNLRALILNDNEISSICKLDLLKDLNSLVLSRNPISEIGDSLSKLKNL 154 Query 62 GH 63 Sbjct 155 SK 156 Score = 29.3 bits (64), Expect = 1.7, Method: Compositional matrix adjust. Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 2/70 (2%) Query 1 DNKLTSLYPVRLAANLVYLNASNNQIRSAAELSANAKLEHVDLRRNLITSLG--DILSYL 58 +NKL SL + L LNA N+++S E+S+ L + L N I+S+ D+L L Sbjct 72 ENKLQSLNGIEALTKLTVLNAGKNKLKSMNEISSLVNLRALILNDNEISSICKLDLLKDL 131 Query 59 TTLGHANVPL 68 +L + P+ Sbjct 132 NSLVLSRNPI 141 Score = 28.9 bits (63), Expect = 2.2, Method: Compositional matrix adjust. Identities = 19/60 (31%), Positives = 38/60 (63%), Gaps = 3/60 (5%) Query 10 VRLAANLVYLNASNNQIRS-AAELSANAKLEHVDLRRNLITSLG--DILSYLTTLGHANV 66 ++ ++L L +NN+I++ AEL+ N +L ++D+ N+IT L ++L L+ L + N+ Sbjct 171 LKSCSDLKELRLANNEIKALPAELAVNKRLLNLDVGNNVITQLSGLEVLGTLSCLRNLNI 230 > At1g33600 Length=478 Score = 29.6 bits (65), Expect = 1.3, Method: Compositional matrix adjust. Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Query 12 LAANLVYLNASNNQIR-SAAELSANAKLEHVDLRRNLI 48 LA NL AS N++R +L+ + +LE +DL RNLI Sbjct 390 LAHNLYEFQASGNKLRFDMGKLNLSERLESLDLSRNLI 427 > 7291344 Length=287 Score = 29.6 bits (65), Expect = 1.6, Method: Compositional matrix adjust. Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Query 9 PVRLAANLVYLNASNNQIRS-AAELSANAKLEHVDLRRNLITSLG 52 P++L Y+N + N+IR+ L KLE +DL +N+I +LG Sbjct 68 PIQLNPETKYINLTVNRIRTLEFSLPFYMKLEILDLSQNIIETLG 112 > 7301474 Length=431 Score = 28.9 bits (63), Expect = 2.5, Method: Compositional matrix adjust. Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Query 2 NKLTSLYP-VRLAANLVYLNASNNQIRSAA-ELSANAKLEHVDLRRNLITSLGDILSYLT 59 N+L L P + L L YL+ S N++ E+S L +DL +NL+ +L D ++ L+ Sbjct 208 NQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLS 267 Query 60 TL 61 L Sbjct 268 RL 269 > Hs13027616 Length=259 Score = 28.9 bits (63), Expect = 2.6, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 0/53 (0%) Query 2 NKLTSLYPVRLAANLVYLNASNNQIRSAAELSANAKLEHVDLRRNLITSLGDI 54 N LT L P+ L LN SNN++ L+ L+ ++ NL+ + G + Sbjct 63 NALTHLGPLASLRQLAVLNVSNNRLTGLEPLATCENLQSLNAAGNLLATPGQL 115 Score = 28.5 bits (62), Expect = 3.3, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Query 1 DNKLTSLYPVRLAANLVYLNASNNQIRSAAELSANAK---LEHVDLRRNL 47 +N+LT L P+ NL LNA+ N + + +L A LE++ LR L Sbjct 84 NNRLTGLEPLATCENLQSLNAAGNLLATPGQLQCLAGLPCLEYLRLRDPL 133 > Hs21361633 Length=602 Score = 28.1 bits (61), Expect = 3.6, Method: Compositional matrix adjust. Identities = 16/49 (32%), Positives = 33/49 (67%), Gaps = 1/49 (2%) Query 14 ANLVYLNASNNQIRS-AAELSANAKLEHVDLRRNLITSLGDILSYLTTL 61 ++LV LN S+N+++S AE++ +L+H+D NL+ ++ L+ + +L Sbjct 197 SSLVRLNLSSNELKSLPAEINRMKRLKHLDCNSNLLETIPPELAGMESL 245 > 7304111 Length=526 Score = 28.1 bits (61), Expect = 3.7, Method: Compositional matrix adjust. Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 10/57 (17%) Query 12 LAANLVYLNASNNQIRS--AAELSANAKLEHVDLRRNLI--------TSLGDILSYL 58 L NL YL +NQI + + L +L H+DLR N I T GD L++L Sbjct 297 LEENLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAFTGFGDSLTFL 353 > Hs18141297 Length=1630 Score = 28.1 bits (61), Expect = 4.1, Method: Composition-based stats. Identities = 21/49 (42%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Query 14 ANLVYLNASNNQIRS-AAELSANAKLEHVDLRRNLITSLGDILSYLTTL 61 ANLV L N ++S A LS KLE +DL N + L D L L L Sbjct 151 ANLVTLELRENLLKSLPASLSFLVKLEQLDLGGNDLEVLPDTLGALPNL 199 > 7300250 Length=326 Score = 28.1 bits (61), Expect = 4.1, Method: Compositional matrix adjust. Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 0/45 (0%) Query 2 NKLTSLYPVRLAANLVYLNASNNQIRSAAELSANAKLEHVDLRRN 46 N++ + + ANL L S N + + LS N KLE +DL +N Sbjct 203 NRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKN 247 > At4g26540 Length=1029 Score = 27.7 bits (60), Expect = 4.8, Method: Compositional matrix adjust. Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 6/65 (9%) Query 1 DNKLTSLYPVRLA--ANLVYLNASNNQIRSA--AELSANAKLEHVDLRRNLITSLGDILS 56 +N LT P NL L S NQI EL+ KL H+++ NLIT G+I S Sbjct 319 ENLLTGTIPRSFGKLENLQELQLSVNQISGTIPEELTNCTKLTHLEIDNNLIT--GEIPS 376 Query 57 YLTTL 61 ++ L Sbjct 377 LMSNL 381 > 7294497 Length=737 Score = 27.7 bits (60), Expect = 5.1, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Query 14 ANLVYLNASNNQI---RSAAELSANAKLEHVDLRRNLITSLGDIL 55 NL YLN S+N++ LS ++L+HV L+ N +TSL + L Sbjct 324 GNLEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTSLAEGL 368 > ECU09g0460 Length=218 Score = 27.7 bits (60), Expect = 5.5, Method: Compositional matrix adjust. Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 0/40 (0%) Query 13 AANLVYLNASNNQIRSAAELSANAKLEHVDLRRNLITSLG 52 A ++ YL+ S+N+IR+ + L L+ +DL NLIT + Sbjct 40 AESVEYLDLSDNRIRTISSLENVPNLKVLDLSYNLITDIS 79 > Hs15529980 Length=321 Score = 27.7 bits (60), Expect = 6.2, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 0/50 (0%) Query 2 NKLTSLYPVRLAANLVYLNASNNQIRSAAELSANAKLEHVDLRRNLITSL 51 NK+ + + +L +L+ + NQIR L L+ +DL NLI +L Sbjct 76 NKIQQIENLACIPSLRFLSLAGNQIRQVENLLDLPCLQFLDLSENLIETL 125 > 7296315 Length=1513 Score = 27.7 bits (60), Expect = 6.2, Method: Compositional matrix adjust. Identities = 16/40 (40%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Query 14 ANLVYLNASNNQIRSAAE--LSANAKLEHVDLRRNLITSL 51 A L LN +N++ + + S N++LE +DL RNLI S+ Sbjct 599 AELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSI 638 > CE02013_1 Length=296 Score = 27.3 bits (59), Expect = 6.4, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 0/51 (0%) Query 1 DNKLTSLYPVRLAANLVYLNASNNQIRSAAELSANAKLEHVDLRRNLITSL 51 DN++ L + NLV+L+ S N+I LS LE + L N I ++ Sbjct 41 DNQIEKLENLETLVNLVFLDVSYNRITKIEGLSELINLEELHLVHNKIITI 91 > CE00526 Length=484 Score = 27.3 bits (59), Expect = 6.5, Method: Composition-based stats. Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Query 16 LVYLNASNNQIRSAAELSANAKLEHVDLRRNLITSLGDILSYLTTL 61 L L+ S N+++S A L L+ V LR+N + SL D L YL L Sbjct 142 LEVLSLSVNEVKSLAPLQHCKNLKEVYLRKNCLESL-DELEYLKEL 186 > 7294300 Length=1346 Score = 27.3 bits (59), Expect = 6.5, Method: Compositional matrix adjust. Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 0/39 (0%) Query 15 NLVYLNASNNQIRSAAELSANAKLEHVDLRRNLITSLGD 53 NLV+LN S N++ L+ +D+R N IT LG+ Sbjct 547 NLVWLNISGNRLEKFDYSHIPIGLQWLDVRANRITQLGN 585 > At4g35470 Length=549 Score = 27.3 bits (59), Expect = 6.6, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Query 15 NLVYLNASNNQIRS-AAELSANAKLEHVDLRRNLITSLGDILSYLTTLGHANV 66 NLVYLN +NQ+ S + S +LE +DL N + L + + L +L +V Sbjct 293 NLVYLNLGSNQLSSLPSAFSRLVRLEELDLSCNNLPILPESIGSLVSLKKLDV 345 > 7297490 Length=1115 Score = 27.3 bits (59), Expect = 7.5, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Query 15 NLVYLNASNNQIRSAAELSANAKLEHVDLRRNLITSLG-DILSYLTTL 61 NL L+ S NQ+ S + L ++D+R N IT+L ++ YL ++ Sbjct 432 NLKSLDVSYNQLTSLSVSQLPESLHYLDIRHNKITTLSPQVVEYLYSV 479 > Hs16751843 Length=858 Score = 26.9 bits (58), Expect = 8.1, Method: Compositional matrix adjust. Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Query 2 NKLTSLYPVRLAANLVYLNASNNQIRSAAELSANAKLEHVDLRRNLITSLGDILSYLTTL 61 N+LT L L ANL L+ S NQ+ A L +D+ N ++ +++ L Sbjct 536 NRLTVLSHNDLPANLEILDISRNQLL-APNPDVFVSLSVLDITHNKFICECELSTFINWL 594 Query 62 GHANVPLKG 70 H NV + G Sbjct 595 NHTNVTIAG 603 > CE24708 Length=787 Score = 26.9 bits (58), Expect = 8.5, Method: Composition-based stats. Identities = 27/74 (36%), Positives = 35/74 (47%), Gaps = 7/74 (9%) Query 1 DNKLTSLYP-VRLAANLVYLNASNNQIRS-AAELSANAKLEHVDLRRN----LITSLGDI 54 +N LT L P + NL L+ SNN++RS EL L H+ L N L LG + Sbjct 96 NNGLTRLPPEIAQLTNLTMLDISNNKLRSLPTELGDMISLCHLYLNNNQLRVLPYELGKL 155 Query 55 LSYLTTLGHANVPL 68 + TLG PL Sbjct 156 FR-IQTLGLQGNPL 168 > CE24709 Length=794 Score = 26.9 bits (58), Expect = 8.5, Method: Composition-based stats. Identities = 27/74 (36%), Positives = 35/74 (47%), Gaps = 7/74 (9%) Query 1 DNKLTSLYP-VRLAANLVYLNASNNQIRS-AAELSANAKLEHVDLRRN----LITSLGDI 54 +N LT L P + NL L+ SNN++RS EL L H+ L N L LG + Sbjct 103 NNGLTRLPPEIAQLTNLTMLDISNNKLRSLPTELGDMISLCHLYLNNNQLRVLPYELGKL 162 Query 55 LSYLTTLGHANVPL 68 + TLG PL Sbjct 163 FR-IQTLGLQGNPL 175 > Hs21389483_1 Length=440 Score = 26.9 bits (58), Expect = 9.6, Method: Compositional matrix adjust. Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 0/56 (0%) Query 2 NKLTSLYPVRLAANLVYLNASNNQIRSAAELSANAKLEHVDLRRNLITSLGDILSY 57 NK+ L V L+ LNAS N + + L+ D N I+ + D+ +Y Sbjct 159 NKIEDLSCVSCMPYLLELNASQNNLTTFFNFKPPKNLKKADFSHNQISEICDLSAY 214 > YOR373w Length=851 Score = 26.9 bits (58), Expect = 9.7, Method: Compositional matrix adjust. Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 3/67 (4%) Query 1 DNKLTSLYPVRLAANLVYLNASNNQIRSA-AELSANAKLEHVDLRRNLITSLGDILSYLT 59 DN++ +L + +N+V L SNN+I SA L+ LE +DL NL+ + LS Sbjct 509 DNEMNTLEGI--PSNVVQLFCSNNKITSAHCSLAGFHDLECLDLSYNLLNTSLKFLSLCH 566 Query 60 TLGHANV 66 L N+ Sbjct 567 HLQEVNL 573 Lambda K H 0.317 0.132 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1190896168 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40