bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6487_orf1 Length=124 Score E Sequences producing significant alignments: (Bits) Value SPAC2C4.12c_1 48.5 3e-06 7295099_1 47.0 9e-06 At2g45330 45.1 3e-05 At5g23600 43.5 9e-05 Hs13899325 32.0 0.26 CE08356 28.9 2.2 7292612 28.9 2.2 YMR232w 27.3 6.2 At3g48360 27.3 7.1 > SPAC2C4.12c_1 Length=225 Score = 48.5 bits (114), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 0/57 (0%) Query 43 KKLNFILRHGASLFRLRIREDGFVRVRDLLALPCMRSVTWNDLKSAVEGNFKRRYEL 99 K L+ +LRH A L+IREDG++ V +L LP R + L S V+GN K+R+ + Sbjct 39 KALSKVLRHTAKANGLQIREDGYIEVDSILKLPQFRGMGMELLLSIVKGNDKKRFTM 95 > 7295099_1 Length=245 Score = 47.0 bits (110), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 26/62 (41%), Positives = 34/62 (54%), Gaps = 0/62 (0%) Query 41 LIKKLNFILRHGASLFRLRIREDGFVRVRDLLALPCMRSVTWNDLKSAVEGNFKRRYELV 100 L KKL+++LRHGA + IR DGFV V DL P T LK + K+RY L Sbjct 11 LSKKLSWLLRHGAKTEGITIRADGFVSVPDLQKHPRYLCFTLEKLKEIAAADAKQRYTLR 70 Query 101 YD 102 ++ Sbjct 71 WN 72 > At2g45330 Length=257 Score = 45.1 bits (105), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 26/69 (37%), Positives = 41/69 (59%), Gaps = 7/69 (10%) Query 45 LNFILRHGASLFRLRIREDGFVRVRDLLALPC-------MRSVTWNDLKSAVEGNFKRRY 97 L ILRH A+ RL +R DGFV+V DLL L ++S T ++++ AV + K+R+ Sbjct 59 LTRILRHMATELRLNMRGDGFVKVEDLLNLNLKTSANIQLKSHTIDEIREAVRRDNKQRF 118 Query 98 ELVYDKTEV 106 L+ + E+ Sbjct 119 SLIDENGEL 127 > At5g23600 Length=212 Score = 43.5 bits (101), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 7/69 (10%) Query 45 LNFILRHGASLFRLRIREDGFVRVRDLLALPC-------MRSVTWNDLKSAVEGNFKRRY 97 L ILRH A+ RL +R DGFV+V DLL L + S T ++++ AV + K+R+ Sbjct 14 LTRILRHMATELRLNMRGDGFVKVEDLLNLNLKTCANIQLNSHTIDEIREAVTRDNKKRF 73 Query 98 ELVYDKTEV 106 L+ + E+ Sbjct 74 SLIDEDGEL 82 > Hs13899325 Length=204 Score = 32.0 bits (71), Expect = 0.26, Method: Compositional matrix adjust. Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 0/37 (0%) Query 63 DGFVRVRDLLALPCMRSVTWNDLKSAVEGNFKRRYEL 99 DGFV + LL LP R + D++ V+ N K+R+ L Sbjct 4 DGFVPLGTLLQLPQFRGFSAEDVQRVVDTNRKQRFAL 40 > CE08356 Length=577 Score = 28.9 bits (63), Expect = 2.2, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 0/28 (0%) Query 82 WNDLKSAVEGNFKRRYELVYDKTEVETC 109 WN L + E N KRR YD EV C Sbjct 318 WNGLPHSSEWNPKRRARFFYDDLEVVDC 345 > 7292612 Length=487 Score = 28.9 bits (63), Expect = 2.2, Method: Composition-based stats. Identities = 11/18 (61%), Positives = 13/18 (72%), Gaps = 0/18 (0%) Query 46 NFILRHGASLFRLRIRED 63 NF LRHG SLF ++ED Sbjct 255 NFCLRHGTSLFYTSVKED 272 > YMR232w Length=677 Score = 27.3 bits (59), Expect = 6.2, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 26/63 (41%), Gaps = 15/63 (23%) Query 60 IREDGFVRVRDLLALPCMRSVTWNDLKSAVEGNF---------------KRRYELVYDKT 104 ++E G +++ D+L P R W D +E + +R+Y L +K Sbjct 266 LKESGCIKLEDILKSPMKRLTQWIDTLETLESCYEDILSPELGLKLSPTRRKYSLFSNKL 325 Query 105 EVE 107 E E Sbjct 326 ETE 328 > At3g48360 Length=367 Score = 27.3 bits (59), Expect = 7.1, Method: Compositional matrix adjust. Identities = 22/70 (31%), Positives = 30/70 (42%), Gaps = 7/70 (10%) Query 5 GCTAPGGRAAADEDSSSSSNPDSSCCCAFSARGGYILIKKLNFILRHGASLFRLRIREDG 64 GCT G D + S + S C AFS G L ++RH A R R + G Sbjct 237 GCTLVGPSNVVDNNKKSMTAEKSEPCKAFSTCYG------LQLLIRHFAVCKR-RNNDKG 289 Query 65 FVRVRDLLAL 74 +R + +L L Sbjct 290 CLRCKRMLQL 299 Lambda K H 0.321 0.133 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1187579072 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40