bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6536_orf1 Length=84 Score E Sequences producing significant alignments: (Bits) Value Hs5803074 37.7 0.005 Hs7662140 37.0 0.009 CE07924 36.2 0.014 At1g64280 35.8 0.018 7299829 35.0 0.030 Hs20555355 35.0 0.038 Hs8922569 34.7 0.049 Hs4507183 33.5 0.088 Hs21362105 33.5 0.10 CE00790 33.1 0.13 At4g26120 33.1 0.14 7292686 32.3 0.22 CE29054 32.0 0.32 Hs17017980 31.6 0.35 Hs17017982 31.6 0.36 Hs18552157 31.6 0.38 Hs4505461 31.6 0.39 Hs22049708 31.2 0.47 Hs21361515 31.2 0.48 7291183 30.8 0.60 Hs20547756 30.8 0.68 7298020 30.8 0.70 Hs7662356_2 30.8 0.70 7302944 30.4 0.79 7296295_2 30.4 0.84 Hs20537937 30.4 0.88 7290654 30.4 0.92 Hs7657703 30.0 1.1 CE28921 30.0 1.2 Hs20555480 29.3 1.9 7290098 28.9 2.1 7293159 28.9 2.2 Hs22054224 28.5 3.4 Hs8922528 28.1 4.5 7291038 27.7 4.9 Hs14670360 26.9 9.0 Hs14670364 26.9 9.2 Hs14670362 26.9 9.5 7294226 26.9 9.7 Hs14670366 26.9 9.8 > Hs5803074 Length=552 Score = 37.7 bits (86), Expect = 0.005, Method: Composition-based stats. Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Query 23 GLHSQFSDVTLLCAGGCEIPSHRALLAARCSFFEA 57 G ++F D+TLL G P+H+A+LAAR S+FEA Sbjct 373 GAGAEFCDITLLLDGHPR-PAHKAILAARSSYFEA 406 > Hs7662140 Length=539 Score = 37.0 bits (84), Expect = 0.009, Method: Compositional matrix adjust. Identities = 17/31 (54%), Positives = 22/31 (70%), Gaps = 0/31 (0%) Query 27 QFSDVTLLCAGGCEIPSHRALLAARCSFFEA 57 +F DVTL AGG + P+HRA+LAA +F A Sbjct 33 KFLDVTLEAAGGRDFPAHRAVLAAASPYFRA 63 > CE07924 Length=581 Score = 36.2 bits (82), Expect = 0.014, Method: Composition-based stats. Identities = 17/31 (54%), Positives = 20/31 (64%), Gaps = 0/31 (0%) Query 29 SDVTLLCAGGCEIPSHRALLAARCSFFEAKL 59 SDVTL+ G E +HR +LA R SFF A L Sbjct 64 SDVTLVLDDGTEFAAHRLILAVRSSFFRAML 94 > At1g64280 Length=593 Score = 35.8 bits (81), Expect = 0.018, Method: Composition-based stats. Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 0/49 (0%) Query 28 FSDVTLLCAGGCEIPSHRALLAARCSFFEAKLTRPHWEAQGPDKAVIDL 76 +SD L+ + G E+ HR +L+AR SFF++ L E + A + L Sbjct 64 YSDAKLVLSDGREVSFHRCVLSARSSFFKSALAAAKKEKDSNNTAAVKL 112 > 7299829 Length=377 Score = 35.0 bits (79), Expect = 0.030, Method: Composition-based stats. Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Query 20 DVGGL--HSQFSDVTLLCAGGCEIPSHRALLAARCSFFEAKLTRPHWEAQGPDKAVIDL 76 D+G L + +FSDVTL GG E +H+A+LAAR F A E + A+ D+ Sbjct 192 DLGNLFDNEKFSDVTL-SVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDV 249 > Hs20555355 Length=612 Score = 35.0 bits (79), Expect = 0.038, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 4/55 (7%) Query 13 SKHHGGCDVGGLHSQFSDVTLLCAGGCEIPSHRALLAARCSFFEAKLTRPHWEAQ 67 S+H G +G ++ DVT + P+HR +LAARC +F A L E+Q Sbjct 23 SEHIGALLIG---EEYGDVTFVVEKK-RFPAHRVILAARCQYFRALLYGGMRESQ 73 > Hs8922569 Length=410 Score = 34.7 bits (78), Expect = 0.049, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Query 29 SDVTLLCAGGCEIPSHRALLAARCSFFEAKL-TRPHWEAQ 67 +DV L+ C P HRA+LAARC FF+ L + P + A+ Sbjct 142 TDVDLIFQETC-FPVHRAILAARCPFFKTLLSSSPEYGAE 180 > Hs4507183 Length=374 Score = 33.5 bits (75), Expect = 0.088, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 3/40 (7%) Query 20 DVGGL--HSQFSDVTLLCAGGCEIPSHRALLAARCSFFEA 57 ++GGL +S+F+D L C G E +H+A+LAAR F A Sbjct 189 ELGGLWENSRFTDCCL-CVAGQEFQAHKAILAARSPVFSA 227 > Hs21362105 Length=589 Score = 33.5 bits (75), Expect = 0.10, Method: Compositional matrix adjust. Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Query 25 HSQFSDVTLLCAGGCEIPSHRALLAARCSFFEAKLT 60 H F+DVTL AG P HRA+LAA +FEA + Sbjct 42 HCMFTDVTLW-AGDRAFPCHRAVLAASSRYFEAMFS 76 > CE00790 Length=418 Score = 33.1 bits (74), Expect = 0.13, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query 27 QFSDVTLLCAGGCEIPSHRALLAARCSFFEAKLTRPH 63 +FSD ++ + G E P+H +LAAR +F+ L R H Sbjct 230 EFSDFIIVASCGREFPTHMCILAARSEYFKV-LLRNH 265 > At4g26120 Length=600 Score = 33.1 bits (74), Expect = 0.14, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 0/32 (0%) Query 28 FSDVTLLCAGGCEIPSHRALLAARCSFFEAKL 59 +SD L+ AGG E+ HR +L+AR F++ L Sbjct 66 YSDAKLVLAGGREVSFHRCILSARIPVFKSAL 97 > 7292686 Length=291 Score = 32.3 bits (72), Expect = 0.22, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Query 29 SDVTLLCAGGCEIPSHRALLAARCSFFEAKLTRPHW 64 SD+ LL G E P+HR +L A F+ L P W Sbjct 143 SDIVLLVDGK-EFPAHRVILCASSDVFQVMLMNPEW 177 > CE29054 Length=451 Score = 32.0 bits (71), Expect = 0.32, Method: Composition-based stats. Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 7/45 (15%) Query 20 DVGGL--HSQFSDVTLLCAGGCEIPS-----HRALLAARCSFFEA 57 D+ GL + QFSD TL+C P+ H+A+LAAR F A Sbjct 254 DMYGLFDNKQFSDFTLVCKSDLGSPTQTFHIHKAILAARSRVFSA 298 > Hs17017980 Length=720 Score = 31.6 bits (70), Expect = 0.35, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Query 27 QFSDVTLLCAGGCEIPSHRALLAARCSFFEAKLTRPHWEAQ 67 Q DV LL AG IP+HR +L+A +F A T EA+ Sbjct 180 QLCDV-LLIAGHLRIPAHRLVLSAVSDYFAAMFTNDVLEAK 219 > Hs17017982 Length=718 Score = 31.6 bits (70), Expect = 0.36, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Query 27 QFSDVTLLCAGGCEIPSHRALLAARCSFFEAKLTRPHWEAQ 67 Q DV LL AG IP+HR +L+A +F A T EA+ Sbjct 180 QLCDV-LLIAGHLRIPAHRLVLSAVSDYFAAMFTNDVLEAK 219 > Hs18552157 Length=649 Score = 31.6 bits (70), Expect = 0.38, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query 25 HSQFSDVTLLCAGGCEIPSHRALLAARCSFFEA 57 + +DVTLL GG E+P HR LLA +F A Sbjct 29 QPKLADVTLLV-GGRELPCHRGLLALSSPYFHA 60 > Hs4505461 Length=589 Score = 31.6 bits (70), Expect = 0.39, Method: Composition-based stats. Identities = 19/40 (47%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Query 28 FSDVTLLCAGGCEIPSHRALLAARCSFFEAKLTRPHWEAQ 67 F+DV LL AG P HRA+LAA +FEA + E+Q Sbjct 45 FTDV-LLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQ 83 > Hs22049708 Length=649 Score = 31.2 bits (69), Expect = 0.47, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query 28 FSDVTLLCAGGCEIPSHRALLAARCSFFEA 57 +DV++ CAG EIP HR +LA+ +F A Sbjct 101 LTDVSI-CAGAREIPCHRNVLASSSPYFRA 129 > Hs21361515 Length=734 Score = 31.2 bits (69), Expect = 0.48, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Query 25 HSQFSDVTLLCAGGCEIPSHRALLAARCSFFEAKLTRPHWEAQ 67 H Q DV +L AG IP+HR +L++ +F A T EA+ Sbjct 216 HKQLCDV-ILVAGDRRIPAHRLVLSSVSDYFAAMFTNDVREAR 257 > 7291183 Length=722 Score = 30.8 bits (68), Expect = 0.60, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Query 24 LHSQFSDVTLLCAGGCEIPSHRALLAARCSFFEAKL 59 ++ Q++DV + IP+HR +LAAR +F A L Sbjct 41 MNEQYADVEFIVEEE-RIPAHRVILAARSEYFRALL 75 > Hs20547756 Length=1353 Score = 30.8 bits (68), Expect = 0.68, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 0/41 (0%) Query 26 SQFSDVTLLCAGGCEIPSHRALLAARCSFFEAKLTRPHWEA 66 S DVT+ G E P H+ +L AR +F + L+ EA Sbjct 765 SFLCDVTMKSVDGKEFPCHKCVLCARLEYFHSMLSSSWIEA 805 > 7298020 Length=627 Score = 30.8 bits (68), Expect = 0.70, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 26/38 (68%), Gaps = 2/38 (5%) Query 25 HSQFSDVTLLCAGGCEIPSHRALLAARCSFFEAKLTRP 62 S+F DV ++ AG + +HRA+L+A ++FEA + RP Sbjct 79 QSRFCDVEII-AGMATLSAHRAVLSAASAYFEA-MFRP 114 > Hs7662356_2 Length=358 Score = 30.8 bits (68), Expect = 0.70, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 0/30 (0%) Query 38 GCEIPSHRALLAARCSFFEAKLTRPHWEAQ 67 G +P+HRA+L ARC A + EA+ Sbjct 175 GTTVPAHRAILVARCEVMAAMFNGNYMEAK 204 > 7302944 Length=1187 Score = 30.4 bits (67), Expect = 0.79, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 0/32 (0%) Query 25 HSQFSDVTLLCAGGCEIPSHRALLAARCSFFE 56 H + DV ++C G + +H+ +L AR +FE Sbjct 690 HPELYDVRIVCKDGKVLGAHKCMLVARLEYFE 721 > 7296295_2 Length=488 Score = 30.4 bits (67), Expect = 0.84, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 0/37 (0%) Query 24 LHSQFSDVTLLCAGGCEIPSHRALLAARCSFFEAKLT 60 L ++D+ L+ AGG + HR +LAA S F+ L+ Sbjct 12 LSQAYTDLVLVGAGGTKFAVHRFMLAAASSIFQRLLS 48 > Hs20537937 Length=617 Score = 30.4 bits (67), Expect = 0.88, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Query 30 DVTLLCAGGCEI-PSHRALLAARCSFFEAKLT 60 DVTL+ G EI P HRA++A+ +F+A T Sbjct 51 DVTLVPGDGDEIFPVHRAMMASASDYFKAMFT 82 > 7290654 Length=682 Score = 30.4 bits (67), Expect = 0.92, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query 28 FSDVTLLCAGGCEIPSHRALLAARCSFFEAKLT 60 F DVTL C G I +HR +L A +FF+A L+ Sbjct 30 FCDVTLACEGQL-IRAHRVVLCACSTFFDAVLS 61 > Hs7657703 Length=1053 Score = 30.0 bits (66), Expect = 1.1, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Query 24 LHSQFSDVTLLCAGGCEIPSHRALLAARCSFFEAKLTRPHWEAQGPDKAVIDLRAF 79 L +QF DVTLL G E +H+++L+A +F A +AV+DL F Sbjct 209 LSNQFCDVTLLIEGE-EYKAHKSVLSANSEYFRDLFIEKG--AVSSHEAVVDLSGF 261 > CE28921 Length=276 Score = 30.0 bits (66), Expect = 1.2, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Query 27 QFSDVTLLCAGGC--EIPSHRALLAARCSFFE 56 +FSDVT AG +P+H+ +LAAR F++ Sbjct 61 RFSDVTFKFAGNSLKSVPAHKYVLAARTDFWK 92 > Hs20555480 Length=473 Score = 29.3 bits (64), Expect = 1.9, Method: Compositional matrix adjust. Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Query 24 LHSQFSDVTLLCAGGCEIPSHRALLAARCSFFEAKL 59 L +F DV+LL G E+ +H+A+LAA +F KL Sbjct 43 LEGKFCDVSLLVQGR-ELRAHKAVLAAASPYFHDKL 77 > 7290098 Length=975 Score = 28.9 bits (63), Expect = 2.1, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Query 28 FSDVTLLCAGGCEIPSHRALLAARCSFFEA 57 F D++L+ IP+H+++L++RC++F+ Sbjct 800 FCDISLVLEDHV-IPAHKSVLSSRCTYFQG 828 > 7293159 Length=514 Score = 28.9 bits (63), Expect = 2.2, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query 27 QFSDVTLLCAGGCEIPSHRALLAARCSFFEAKL 59 +F DVTL C G ++ HR +LAA ++FEA L Sbjct 31 RFVDVTLACEGQ-QVHCHRLVLAACSTYFEAIL 62 > Hs22054224 Length=831 Score = 28.5 bits (62), Expect = 3.4, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Query 14 KHHGGCDVGGLHSQFS-----DVTLLCAGGCEIPSHRALLAARCSFFEA 57 K HGG + G + + DVTL G E P+HR+LLA +F A Sbjct 315 KAHGGALLTGYQALRAEGFLCDVTLETEG-SEFPAHRSLLACSSDYFRA 362 > Hs8922528 Length=708 Score = 28.1 bits (61), Expect = 4.5, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 4/36 (11%) Query 28 FSDVTLLC---AGGCEIPSHRALLAARCSFFEAKLT 60 F D+TL C AGG E +HR++LAA +F L+ Sbjct 93 FCDITL-CFGGAGGREFRAHRSVLAAATEYFTPLLS 127 > 7291038 Length=625 Score = 27.7 bits (60), Expect = 4.9, Method: Compositional matrix adjust. Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query 27 QFSDVTLLCA-GGCEIPSHRALLAARCSFFEAKLT 60 Q DV L+ G +P+HR +L+A ++F A T Sbjct 73 QLCDVVLIAGIDGKRVPAHRLVLSASSAYFSAMFT 107 > Hs14670360 Length=687 Score = 26.9 bits (58), Expect = 9.0, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query 27 QFSDVTLLCAGGCEIPSHRALLAARCSFFEA 57 +F DV LL G P+HRA+LAA +FE+ Sbjct 39 RFCDV-LLRVGDESFPAHRAVLAACSEYFES 68 > Hs14670364 Length=537 Score = 26.9 bits (58), Expect = 9.2, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query 27 QFSDVTLLCAGGCEIPSHRALLAARCSFFEA 57 +F DV LL G P+HRA+LAA +FE+ Sbjct 39 RFCDV-LLRVGDESFPAHRAVLAACSEYFES 68 > Hs14670362 Length=641 Score = 26.9 bits (58), Expect = 9.5, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query 27 QFSDVTLLCAGGCEIPSHRALLAARCSFFEA 57 +F DV LL G P+HRA+LAA +FE+ Sbjct 39 RFCDV-LLRVGDESFPAHRAVLAACSEYFES 68 > 7294226 Length=623 Score = 26.9 bits (58), Expect = 9.7, Method: Compositional matrix adjust. Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Query 25 HSQFSDVTLLCAGGCEIPSHRALLAARCSFFEAKLTRPHWEAQGPDKAVIDL 76 H + DV +L GG +I +HR +L+A S+F A T E++ + + D+ Sbjct 68 HRELCDV-VLNVGGRKIFAHRVILSACSSYFCAMFTGELEESRQTEVTIRDI 118 > Hs14670366 Length=537 Score = 26.9 bits (58), Expect = 9.8, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query 27 QFSDVTLLCAGGCEIPSHRALLAARCSFFEA 57 +F DV LL G P+HRA+LAA +FE+ Sbjct 39 RFCDV-LLRVGDESFPAHRAVLAACSEYFES 68 Lambda K H 0.323 0.137 0.454 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1197406694 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40