bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6746_orf1 Length=132 Score E Sequences producing significant alignments: (Bits) Value Hs4507433 42.0 3e-04 At5g47130 42.0 3e-04 Hs14757108 42.0 3e-04 At4g17580 33.5 0.11 7295121 32.7 0.21 Hs17454125 28.1 4.4 > Hs4507433 Length=237 Score = 42.0 bits (97), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 17/39 (43%), Positives = 26/39 (66%), Gaps = 0/39 (0%) Query 85 AATAQVVPAAFLASVAIFCCLSAAALVAKQRSYLYLGSI 123 A ++P AF+ + IF C + +AL A++RSYL+LG I Sbjct 108 AVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGI 146 > At5g47130 Length=187 Score = 42.0 bits (97), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 17/45 (37%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 88 AQVVPAAFLASVAIFCCLSAAALVAKQRSYLYLGSILGAAITYLS 132 + ++ AFL + IF C SA A++A++R Y+YLG +L + + L+ Sbjct 60 SSILITAFLGTAVIFFCFSAVAMLARRREYIYLGGLLSSGFSLLT 104 > Hs14757108 Length=237 Score = 42.0 bits (97), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 17/39 (43%), Positives = 26/39 (66%), Gaps = 0/39 (0%) Query 85 AATAQVVPAAFLASVAIFCCLSAAALVAKQRSYLYLGSI 123 A ++P AF+ + IF C + +AL A++RSYL+LG I Sbjct 108 AVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGI 146 > At4g17580 Length=247 Score = 33.5 bits (75), Expect = 0.11, Method: Compositional matrix adjust. Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 0/37 (0%) Query 88 AQVVPAAFLASVAIFCCLSAAALVAKQRSYLYLGSIL 124 + V+ AF+ + F C SAAA++A +R YLY G+ L Sbjct 118 SSVLVTAFVGTAVAFVCFSAAAMLATRREYLYHGASL 154 > 7295121 Length=245 Score = 32.7 bits (73), Expect = 0.21, Method: Compositional matrix adjust. Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 0/40 (0%) Query 90 VVPAAFLASVAIFCCLSAAALVAKQRSYLYLGSILGAAIT 129 ++ +A + F LS +AL+A+Q YLYLG +L + I Sbjct 116 IILSALTGTFVTFISLSLSALLAEQGKYLYLGGMLVSVIN 155 > Hs17454125 Length=1849 Score = 28.1 bits (61), Expect = 4.4, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 0/41 (0%) Query 70 LLPLCCCCCCRCCAAAATAQVVPAAFLASVAIFCCLSAAAL 110 LL CCC C T ++ PA L + +F S +AL Sbjct 684 LLGALCCCICDPGVNVVTQEIKPAESLGQLLLFHLNSKSAL 724 Lambda K H 0.330 0.133 0.460 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1319765976 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40