bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6754_orf3 Length=55 Score E Sequences producing significant alignments: (Bits) Value CE22211 33.5 0.11 Hs11024704 32.3 0.20 7298929 32.3 0.22 > CE22211 Length=390 Score = 33.5 bits (75), Expect = 0.11, Method: Composition-based stats. Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Query 3 EVGKMVKKILDISRVWWLRQKGFMTATLKQFVESGETPECFVIVA 47 E+G+ K IL+I R WL GF T + ++V +PE +I+A Sbjct 345 ELGRRAKAILEIGRAIWLESVGFKTRVV-EYVPPEVSPENLLILA 388 > Hs11024704 Length=481 Score = 32.3 bits (72), Expect = 0.20, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Query 1 KREVGKMVKKILDISRVWWLRQKGFMTATLKQFVESGETPECFVIVANPHSGSS 54 K+++G + K ++D R+ +L+QKGF A L+ + + + E ++ A P+ SS Sbjct 424 KKKIGHLCKLLIDQGRIQYLQQKGFSPA-LQYYTDPLVSLENVLLTALPNHSSS 476 > 7298929 Length=434 Score = 32.3 bits (72), Expect = 0.22, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Query 1 KREVGKMVKKILDISRVWWLRQKGFMTATLKQFVESGETPECFVIVANPHS 51 + ++G+ K++LD R+ LR G+ A LK +V T E V++A P S Sbjct 376 REQIGQQCKRVLDYGRLEHLRSHGYQ-AELKFYVPRDVTLENVVLLARPTS 425 Lambda K H 0.319 0.132 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1197145602 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40