bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7355_orf1 Length=62 Score E Sequences producing significant alignments: (Bits) Value Hs16579885 43.5 9e-05 SPBP8B7.03c 43.1 1e-04 Hs14741953 42.0 3e-04 At5g02870 40.8 6e-04 At3g09630 40.8 6e-04 SPBC1711.06 38.9 0.002 ECU08g0830 38.9 0.002 CE07669 38.9 0.002 Hs18583527_2 37.7 0.005 YBR031w 34.3 0.053 YDR012w 34.3 0.058 > Hs16579885 Length=427 Score = 43.5 bits (101), Expect = 9e-05, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 40/62 (64%), Gaps = 2/62 (3%) Query 1 STARLSVLLLAPGGVVGRLCVFTAAALQQLQQLFGDPSGLAAAPRKRRYHLLRPLLQNPD 60 + ++L++L LAPGG VGR C++T +A ++L +L+G + AA K Y+L + N D Sbjct 231 NVSKLNILKLAPGGHVGRFCIWTESAFRKLDELYG--TWRKAASLKSNYNLPMHKMINTD 288 Query 61 VA 62 ++ Sbjct 289 LS 290 > SPBP8B7.03c Length=363 Score = 43.1 bits (100), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 2/58 (3%) Query 4 RLSVLLLAPGGVVGRLCVFTAAALQQLQQLFGDPSGLAAAPRKRRYHLLRPLLQNPDV 61 RL++L LAPGG +GR ++T +A L +FG S AA K+ Y L ++ N DV Sbjct 234 RLNLLQLAPGGHLGRFVIWTKSAFGLLDSVFG--STTEAAQLKKNYFLPENIISNADV 289 > Hs14741953 Length=352 Score = 42.0 bits (97), Expect = 3e-04, Method: Composition-based stats. Identities = 22/62 (35%), Positives = 39/62 (62%), Gaps = 2/62 (3%) Query 1 STARLSVLLLAPGGVVGRLCVFTAAALQQLQQLFGDPSGLAAAPRKRRYHLLRPLLQNPD 60 + ++L++ LAPGG VGR C++T +A ++L +L+G + AA K Y+L + N D Sbjct 136 NVSKLTISKLAPGGHVGRFCIWTGSAFRKLDELYG--TWRKAASLKSNYNLPMHKMINTD 193 Query 61 VA 62 ++ Sbjct 194 LS 195 > At5g02870 Length=407 Score = 40.8 bits (94), Expect = 6e-04, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 2/59 (3%) Query 4 RLSVLLLAPGGVVGRLCVFTAAALQQLQQLFGDPSGLAAAPRKRRYHLLRPLLQNPDVA 62 RL++L LAPGG +GR ++T +A ++L+ ++G S + +K+ Y L R + N D+A Sbjct 241 RLNLLKLAPGGHLGRFVIWTKSAFEKLESIYG--SFEKPSEKKKGYVLPRAKMVNADLA 297 > At3g09630 Length=406 Score = 40.8 bits (94), Expect = 6e-04, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 2/59 (3%) Query 4 RLSVLLLAPGGVVGRLCVFTAAALQQLQQLFGDPSGLAAAPRKRRYHLLRPLLQNPDVA 62 RL++L LAPGG +GR ++T +A ++L+ ++G S + +K+ Y L R + N D+A Sbjct 240 RLNLLKLAPGGHLGRFVIWTKSAFEKLESIYG--SFEKPSEKKKGYVLPRAKMVNADLA 296 > SPBC1711.06 Length=363 Score = 38.9 bits (89), Expect = 0.002, Method: Composition-based stats. Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Query 4 RLSVLLLAPGGVVGRLCVFTAAALQQLQQLFGDPSGLAAAPRKRRYHLLRPLLQNPDV 61 RL++L LAPGG +GR ++T +A L +FG S A K+ Y L ++ N DV Sbjct 234 RLNLLQLAPGGHLGRFVIWTKSAFGLLDSVFG--STTEVAQLKKNYFLPENIISNADV 289 > ECU08g0830 Length=335 Score = 38.9 bits (89), Expect = 0.002, Method: Composition-based stats. Identities = 17/35 (48%), Positives = 25/35 (71%), Gaps = 0/35 (0%) Query 1 STARLSVLLLAPGGVVGRLCVFTAAALQQLQQLFG 35 S L +L LAPGGV GRL ++T +A ++L ++FG Sbjct 227 SIDSLDLLELAPGGVAGRLIIWTESAFEKLDKIFG 261 > CE07669 Length=345 Score = 38.9 bits (89), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/62 (30%), Positives = 38/62 (61%), Gaps = 1/62 (1%) Query 1 STARLSVLLLAPGGVVGRLCVFTAAALQQLQQLFGDPSGLAAAPRKRRYHLLRPLLQNPD 60 + RL++L LAPGG +GRL ++T +A ++L ++G ++ K+ + + P++ N D Sbjct 230 NVERLNLLKLAPGGHLGRLIIWTESAFKKLDTIYGTTVA-NSSQLKKGWSVPLPIMANSD 288 Query 61 VA 62 + Sbjct 289 FS 290 > Hs18583527_2 Length=276 Score = 37.7 bits (86), Expect = 0.005, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 2/60 (3%) Query 3 ARLSVLLLAPGGVVGRLCVFTAAALQQLQQLFGDPSGLAAAPRKRRYHLLRPLLQNPDVA 62 ++L++L LAPGG VG C++T +A +L + G + AA K Y+L + N D++ Sbjct 127 SKLNILKLAPGGHVGHFCIWTQSAFWKLDEFSG--TWHKAASLKSNYNLPMHKMINTDLS 184 > YBR031w Length=362 Score = 34.3 bits (77), Expect = 0.053, Method: Composition-based stats. Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 3/61 (4%) Query 1 STARLSVLLLAPGGVVGRLCVFTAAALQQLQQLFGDPSGLAAAPRKRRYHLLRPLLQNPD 60 + A L++L LAPG +GR ++T AA +L Q++G + A K Y L ++ D Sbjct 229 NVASLNLLQLAPGAHLGRFVIWTEAAFTKLDQVWGSET---VASSKVGYTLPSHIISTSD 285 Query 61 V 61 V Sbjct 286 V 286 > YDR012w Length=362 Score = 34.3 bits (77), Expect = 0.058, Method: Composition-based stats. Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 3/61 (4%) Query 1 STARLSVLLLAPGGVVGRLCVFTAAALQQLQQLFGDPSGLAAAPRKRRYHLLRPLLQNPD 60 + A L++L LAPG +GR ++T AA +L Q++G + A K Y L ++ D Sbjct 229 NVASLNLLQLAPGAHLGRFVIWTEAAFTKLDQVWGSET---VASSKVGYTLPSHIISTSD 285 Query 61 V 61 V Sbjct 286 V 286 Lambda K H 0.325 0.140 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1175803722 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40