bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7375_orf1 Length=62 Score E Sequences producing significant alignments: (Bits) Value CE02609_1 45.1 3e-05 YGL065c 41.2 4e-04 SPBC32H8.14 40.0 0.001 Hs14861836 39.3 0.002 At1g78800 37.7 0.005 7292312 35.4 0.029 Hs6996014 29.3 2.1 CE28488 28.9 2.1 Hs15029520 28.9 2.2 7293481 28.5 2.8 SPBC2G2.12 28.5 3.0 At3g17740_2 28.5 3.5 > CE02609_1 Length=384 Score = 45.1 bits (105), Expect = 3e-05, Method: Composition-based stats. Identities = 23/47 (48%), Positives = 30/47 (63%), Gaps = 6/47 (12%) Query 18 SLNRFEEKKNIELALTAVASLPQEI------KCNLIVAGGFDPRLPE 58 SLNRFE KKNI LAL A L + +C+L++AGG+D + PE Sbjct 214 SLNRFERKKNIVLALDAFEKLKSNLPADEFSQCHLVIAGGYDLKNPE 260 > YGL065c Length=503 Score = 41.2 bits (95), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 2/50 (4%) Query 15 YAISLNRFEEKKNIELALTAVASLPQEIKCN--LIVAGGFDPRLPECSAY 62 + +S+NRFE+KK++ LA+ A A +I N L++ GG+D R+ E Y Sbjct 219 FYLSINRFEKKKDVALAIKAFALSEDQINDNVKLVICGGYDERVAENVEY 268 > SPBC32H8.14 Length=511 Score = 40.0 bits (92), Expect = 0.001, Method: Composition-based stats. Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 7/52 (13%) Query 17 ISLNRFEEKKNIELALTAVASLPQEIKCN------LIVAGGFDPRLPECSAY 62 IS+NRFE KK+I LA+ A ++L +++ N L+VAGG+D R+ E Y Sbjct 230 ISVNRFERKKDIRLAIDAFSAL-RDLSANRFPEYLLLVAGGYDIRVSENRRY 280 > Hs14861836 Length=416 Score = 39.3 bits (90), Expect = 0.002, Method: Composition-based stats. Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 6/48 (12%) Query 17 ISLNRFEEKKNIELALTAVASLPQEI------KCNLIVAGGFDPRLPE 58 +S+NR+E KKN+ LAL A+ L + + +LIVAGG+D R+ E Sbjct 229 LSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLE 276 > At1g78800 Length=405 Score = 37.7 bits (86), Expect = 0.005, Method: Composition-based stats. Identities = 24/52 (46%), Positives = 32/52 (61%), Gaps = 6/52 (11%) Query 17 ISLNRFEEKKNIELALTAVASLPQEIK----CNLIVAG--GFDPRLPECSAY 62 +S+NRFE KKNI+LA++A A L + + L VAG G+D RL E Y Sbjct 213 LSINRFERKKNIDLAVSAFAILCKHKQNLSDVTLTVAGKCGYDERLKENVEY 264 > 7292312 Length=424 Score = 35.4 bits (80), Expect = 0.029, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 6/48 (12%) Query 17 ISLNRFEEKKNIELALTAVASLPQEI------KCNLIVAGGFDPRLPE 58 + +NR+E KKN LAL ++ L + +C LI+AGG+D R E Sbjct 226 LDINRYERKKNHALALHSLRLLGDMLPATDFKRCRLIIAGGYDTRCME 273 > Hs6996014 Length=509 Score = 29.3 bits (64), Expect = 2.1, Method: Compositional matrix adjust. Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 10/61 (16%) Query 8 QFDLSVPYA--ISLNRFEEKKNIELALTAVASLPQEIK--------CNLIVAGGFDPRLP 57 ++DL+VP+A +++N+ K +A P + C+ +AG FDP +P Sbjct 128 RYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIP 187 Query 58 E 58 + Sbjct 188 D 188 > CE28488 Length=437 Score = 28.9 bits (63), Expect = 2.1, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Query 1 RPFAELQQFDLSVPYAISLNRFEEKKNIELALTAVASLPQE-IKCNLIVAGGFDPRLPEC 59 RP + Q+ +S+NRF +K +++ + A + L Q+ ++ +AG P +PE Sbjct 189 RPVSRAQRAKNETYTFLSMNRFWPEKRLDIIIEAASILKQKGYHFHVQLAGSVMPHIPES 248 Query 60 SAY 62 Y Sbjct 249 RIY 251 > Hs15029520 Length=506 Score = 28.9 bits (63), Expect = 2.2, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 32/61 (52%), Gaps = 10/61 (16%) Query 8 QFDLSVPYA--ISLNRFEEKKNIELALTAVASLPQEIK--------CNLIVAGGFDPRLP 57 ++DL+VP+A +++N+ ++ K + P ++ C+ +AG FDP +P Sbjct 129 RYDLTVPFARYLAMNKVKKMKRYHVGKVWRRESPTIVQGRYREFCQCDFDIAGQFDPMIP 188 Query 58 E 58 + Sbjct 189 D 189 > 7293481 Length=522 Score = 28.5 bits (62), Expect = 2.8, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 10/61 (16%) Query 8 QFDLSVPYA--ISLNRFEEKKNIELALTAVASLPQEIK--------CNLIVAGGFDPRLP 57 ++DL+VP A +++N+ K +A P K C+ +AG +DP LP Sbjct 131 RYDLTVPLARYLAMNKISSIKRYHIAKVYRRDNPAMTKGRYREFYQCDFDIAGTYDPMLP 190 Query 58 E 58 + Sbjct 191 D 191 > SPBC2G2.12 Length=538 Score = 28.5 bits (62), Expect = 3.0, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 11/65 (16%) Query 8 QFDLSVPYA---------ISLNRFEEKKNIELALTAVAS--LPQEIKCNLIVAGGFDPRL 56 ++DL+VP+A S+ RF K A+ + + +C+ +AG +DP + Sbjct 135 RYDLTVPFARWLAMNPKVTSIKRFHIAKVYRRDQPAMTKGRMREFYQCDFDIAGNYDPMI 194 Query 57 PECSA 61 P+ A Sbjct 195 PDSEA 199 > At3g17740_2 Length=509 Score = 28.5 bits (62), Expect = 3.5, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 20/30 (66%), Gaps = 0/30 (0%) Query 16 AISLNRFEEKKNIELALTAVASLPQEIKCN 45 A S N ++ ++ALT++ LP+E++CN Sbjct 169 AASGNMKHARRVFDMALTSICGLPKELQCN 198 Lambda K H 0.321 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1175803722 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40