bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7390_orf2 Length=84 Score E Sequences producing significant alignments: (Bits) Value YNL256w 43.1 1e-04 SPBC1734.03 39.3 0.002 At4g30000 33.9 0.069 ECU05g1120i 28.1 3.8 At1g69190 27.7 5.3 Hs22058377 27.7 5.5 Hs21359935 27.7 5.7 > YNL256w Length=864 Score = 43.1 bits (100), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 20/47 (42%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Query 4 VDSASYSMQVNTTNLTLPHPRLAQRNFILFPLCD-IKPDLVHPTERE 49 ++SA + VN +L +PHPR+ +R F+L PLC+ I P +HP E Sbjct 439 LNSAGEDIIVNEPDLNIPHPRMLERTFVLEPLCELISPVHLHPVTAE 485 > SPBC1734.03 Length=686 Score = 39.3 bits (90), Expect = 0.002, Method: Compositional matrix adjust. Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 18 LTLPHPRLAQRNFILFPLCDIKPDLVHP 45 LT+PH L +R F+L PL + PDLVHP Sbjct 358 LTIPHLGLQEREFVLRPLLALSPDLVHP 385 > At4g30000 Length=554 Score = 33.9 bits (76), Expect = 0.069, Method: Compositional matrix adjust. Identities = 12/28 (42%), Positives = 21/28 (75%), Gaps = 0/28 (0%) Query 11 MQVNTTNLTLPHPRLAQRNFILFPLCDI 38 M++++ L +PH RL +R+F+L PL D+ Sbjct 188 MRISSDKLIIPHERLWERSFVLAPLVDL 215 > ECU05g1120i Length=337 Score = 28.1 bits (61), Expect = 3.8, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 0/53 (0%) Query 31 ILFPLCDIKPDLVHPTERETMKNLILKNMRRREEALRHSASSSGETSDAARLM 83 I+FP+ +K + V T+R+ + K EE +R S S+AARL+ Sbjct 262 IVFPILQLKGECVRITDRDGREMAFEKYQEFEEEFVRKSIHPGDLKSNAARLI 314 > At1g69190 Length=459 Score = 27.7 bits (60), Expect = 5.3, Method: Composition-based stats. Identities = 10/27 (37%), Positives = 18/27 (66%), Gaps = 0/27 (0%) Query 12 QVNTTNLTLPHPRLAQRNFILFPLCDI 38 ++ + L +PH R+ +R F+L PL D+ Sbjct 90 KIISDKLIIPHERIWERPFVLAPLVDL 116 > Hs22058377 Length=372 Score = 27.7 bits (60), Expect = 5.5, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 8/48 (16%) Query 37 DIKPDLVHPTERETMKNLILKNMRRREE----ALRHSASSSGETSDAA 80 +I+ ++HP RET++N I+ R R+E AL+H G+ DAA Sbjct 14 EIRVTVIHPP-RETLENNIISRERTRKEPKDVALKH---QEGDVKDAA 57 > Hs21359935 Length=2113 Score = 27.7 bits (60), Expect = 5.7, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Query 4 VDSASYSMQVN----TTNLTLPHPRLAQRNFILFPLCDIKPDLVHPTERETMKN 53 V A +S VN T ++L HP L Q L + DI+P +P R+ +K+ Sbjct 1744 VTDAEFSQAVNPQSFCTGVSLHHPTLIQSTGPLIDMSDIRPG-TNPVSRKNVKS 1796 Lambda K H 0.317 0.128 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1197406694 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40