bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_8667_orf2 Length=56 Score E Sequences producing significant alignments: (Bits) Value 7293863 36.2 0.014 7297446 35.8 0.020 CE27556 31.6 0.42 CE20426 31.2 0.51 Hs4557014 30.0 0.97 SPCC757.07c 29.3 1.9 CE20305 29.3 2.1 YBL079w 27.7 6.2 > 7293863 Length=506 Score = 36.2 bits (82), Expect = 0.014, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 0/48 (0%) Query 3 REALIGNIVDHLKHADRHLQERQVKLFYRADKDYGLRVARGLGLPDSA 50 ++ L+ NI HL +A + LQER VK F + D+G + L L S+ Sbjct 457 KKRLVQNIAGHLSNASQFLQERAVKNFTQVHADFGRMLTEELNLAKSS 504 > 7297446 Length=506 Score = 35.8 bits (81), Expect = 0.020, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 0/42 (0%) Query 3 REALIGNIVDHLKHADRHLQERQVKLFYRADKDYGLRVARGL 44 R+ L+ N+ +HL A + LQER VKLF D+G + L Sbjct 457 RKRLVRNLSEHLTEASQFLQERAVKLFTMVHSDFGRLMTEAL 498 > CE27556 Length=901 Score = 31.6 bits (70), Expect = 0.42, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 0/39 (0%) Query 6 LIGNIVDHLKHADRHLQERQVKLFYRADKDYGLRVARGL 44 L G VD + D L RQV +FYRA + L++ + L Sbjct 579 LSGQQVDQMSDHDLELVIRQVTVFYRASPRHKLKIVKAL 617 > CE20426 Length=705 Score = 31.2 bits (69), Expect = 0.51, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 0/39 (0%) Query 6 LIGNIVDHLKHADRHLQERQVKLFYRADKDYGLRVARGL 44 L G VD + D L RQV +FYRA + L++ + L Sbjct 579 LSGQQVDQMSDHDLELVIRQVTVFYRASPRHKLKIVKAL 617 > Hs4557014 Length=527 Score = 30.0 bits (66), Expect = 0.97, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 0/37 (0%) Query 1 DDREALIGNIVDHLKHADRHLQERQVKLFYRADKDYG 37 + R+ L NI HLK A +Q++ VK F DYG Sbjct 454 EQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYG 490 > SPCC757.07c Length=512 Score = 29.3 bits (64), Expect = 1.9, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 0/38 (0%) Query 3 REALIGNIVDHLKHADRHLQERQVKLFYRADKDYGLRV 40 ++ + N+ HL A ++ERQ +F R D + G R+ Sbjct 444 QDNFVKNVAGHLSGAISPVRERQYGVFTRVDSELGRRI 481 > CE20305 Length=1798 Score = 29.3 bits (64), Expect = 2.1, Method: Composition-based stats. Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 5/58 (8%) Query 2 DREALIGNIVDHLKHADR--HLQERQVKLF--YRADKDYGLRVARGLGLPDSACSSSR 55 DR A++ IV LK R H+ E V+L A + G VA LG+PD AC + R Sbjct 1095 DRGAVLEAIVSRLKMITRRSHVTEEPVRLLGLSTALANAG-DVAEWLGIPDEACYNFR 1151 > YBL079w Length=1502 Score = 27.7 bits (60), Expect = 6.2, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Query 6 LIGNIVDHLKHADRHLQERQVKLFYRADKDYGL-RVARGLG 45 L G +DHL+H D + + +Y + DY R GLG Sbjct 103 LAGKYIDHLQHKDSNTPVLDERSYYNSGVDYNFSREKNGLG 143 Lambda K H 0.322 0.139 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1194096762 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40