bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_0130_orf4 Length=167 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_060440 46 kDa FK506-binding nuclear protein, putati... 87.4 2e-17 pfa:PF14_0649 conserved Plasmodium protein, unknown function 42.0 0.001 pfa:PF14_0480 conserved Plasmodium protein, unknown function 35.0 0.12 mmu:353326 Rtl1, 6430411K18Rik, Mar, Mart1, Mor1, Peg11; retro... 32.0 0.93 dre:558299 slc24a1, si:ch211-117i10.3; solute carrier family 2... 30.4 2.9 > tgo:TGME49_060440 46 kDa FK506-binding nuclear protein, putative (EC:5.2.1.8); K11276 nucleophosmin 1 Length=311 Score = 87.4 bits (215), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 53/93 (56%), Positives = 62/93 (66%), Gaps = 5/93 (5%) Query 77 DKKRKQQQQQKQQQQPNKKAKNQGGEANTSS-SGDEASYRNALVDFLKKNGPTPLASLGQ 135 DKKRK + Q NKKAK + + GD A+Y++ALVDFLKKNG TPLA+LGQ Sbjct 222 DKKRKAVEVA---QASNKKAKPSAAPSKGAPQKGDAAAYKSALVDFLKKNGKTPLATLGQ 278 Query 136 KVKKPASLP-KMAAFLKANSDKFAVEGGKCSLK 167 KVKKPA + KMA FLKAN+ F V G CSLK Sbjct 279 KVKKPAGVSEKMAQFLKANASTFDVSNGVCSLK 311 > pfa:PF14_0649 conserved Plasmodium protein, unknown function Length=2558 Score = 42.0 bits (97), Expect = 0.001, Method: Composition-based stats. Identities = 16/84 (19%), Positives = 52/84 (61%), Gaps = 0/84 (0%) Query 24 QAAAANDDEDDEDDEDDEDDEDDDEEGSEDESGEEDEEESEEEEEAPKQQQQQDKKRKQQ 83 Q ++++D+ DE+ ++++D++++ ++DE+ +E+++ES+ E + Q +++++ + Sbjct 2037 QNENQDENQDENQDENQDENQDENQDENQDENRDENQDESQNENQNENQDDNENEEKPNE 2096 Query 84 QQQKQQQQPNKKAKNQGGEANTSS 107 + +++PN + EA+ + Sbjct 2097 GSNENEEKPNDGSIENNEEADKEA 2120 Score = 40.0 bits (92), Expect = 0.003, Method: Composition-based stats. Identities = 17/82 (20%), Positives = 46/82 (56%), Gaps = 0/82 (0%) Query 39 DDEDDEDDDEEGSEDESGEEDEEESEEEEEAPKQQQQQDKKRKQQQQQKQQQQPNKKAKN 98 + +++D++++ ++DE+ +E+++E+++E + + + QD+ + + Q + Q N++ N Sbjct 2036 NQNENQDENQDENQDENQDENQDENQDENQDENRDENQDESQNENQNENQDDNENEEKPN 2095 Query 99 QGGEANTSSSGDEASYRNALVD 120 +G N D + N D Sbjct 2096 EGSNENEEKPNDGSIENNEEAD 2117 Score = 31.2 bits (69), Expect = 1.9, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 33/58 (56%), Gaps = 0/58 (0%) Query 29 NDDEDDEDDEDDEDDEDDDEEGSEDESGEEDEEESEEEEEAPKQQQQQDKKRKQQQQQ 86 N DE+ ++++D+ +E+ +E ++E+ E+ E S E EE P ++ + ++ + Sbjct 2064 NQDENRDENQDESQNENQNENQDDNENEEKPNEGSNENEEKPNDGSIENNEEADKEAK 2121 > pfa:PF14_0480 conserved Plasmodium protein, unknown function Length=1653 Score = 35.0 bits (79), Expect = 0.12, Method: Composition-based stats. Identities = 29/96 (30%), Positives = 51/96 (53%), Gaps = 8/96 (8%) Query 1 EEEDTKKKGKVSSKKGAAALKALQAAAANDDEDDEDDEDDEDDEDDDEEGS-EDESGEED 59 E+EDT K ++K K + +D +D+ EDD ++D E S ED+S E+D Sbjct 986 EKEDTWK-----NQKHKGINKHKDDSHEDDSHEDDSHEDDSHEDDSHENDSHEDDSHEDD 1040 Query 60 EEESEEEEEAPKQQQQQDKKRKQQQQQKQQQQPNKK 95 E++ EE K+Q +K+ ++ ++K + NK+ Sbjct 1041 SHENDSHEE--KEQYIYNKELYEKIKKKPGKNMNKE 1074 > mmu:353326 Rtl1, 6430411K18Rik, Mar, Mart1, Mor1, Peg11; retrotransposon-like 1 Length=1744 Score = 32.0 bits (71), Expect = 0.93, Method: Composition-based stats. Identities = 17/68 (25%), Positives = 34/68 (50%), Gaps = 5/68 (7%) Query 28 ANDDEDDEDDEDDEDDEDDDEEGSEDESGEEDE-----EESEEEEEAPKQQQQQDKKRKQ 82 A+D+ D+ D DD + E ++G+ D+ E E P + Q+K R+Q Sbjct 825 ADDETSDQPSSDGSDDLSESEPSELQQAGDSDQSGVFYESGARETLEPVSARMQEKARQQ 884 Query 83 QQQQKQQQ 90 ++ ++Q++ Sbjct 885 EKAREQEE 892 > dre:558299 slc24a1, si:ch211-117i10.3; solute carrier family 24 (sodium/potassium/calcium exchanger), member 1; K13749 solute carrier family 24 (sodium/potassium/calcium exchanger), member 1 Length=724 Score = 30.4 bits (67), Expect = 2.9, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Query 48 EEGSEDESGEEDE--EESEEEEEAPKQQQQQDKKRKQQQQQKQQQQPNKKAKNQGG 101 E +++SGE D+ E++++ ++AP + +D +K + Q+ ++N GG Sbjct 422 ENKKKEKSGEGDDQSEQTKDSKDAPPGAKDEDTNQKSEAQKDGDIAAGGGSENPGG 477 Lambda K H 0.293 0.117 0.298 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 4092719652 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40