bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_0347_orf3 Length=55 Score E Sequences producing significant alignments: (Bits) Value mmu:17709 COX2; cytochrome c oxidase subunit II (EC:1.9.3.1); ... 100 8e-22 xla:2642081 COX2; cytochrome c oxidase subunit II; K02261 cyto... 87.8 7e-18 dre:140540 COX2, mtco2; cytochrome c oxidase subunit II; K0226... 80.9 1e-15 hsa:4513 COX2, COII, MTCO2; cytochrome c oxidase subunit II; K... 79.7 2e-15 ath:ArthMp015 cox2; cytochrome c oxidase subunit 2; K02261 cyt... 63.2 2e-10 cel:COX2 cytochrome c oxidase subunit II; K02261 cytochrome c ... 62.4 3e-10 sce:Q0250 COX2, OXI1, OXII; Cox2p (EC:1.9.3.1); K02261 cytochr... 53.1 2e-07 tpv:TP01_0683 cytochrome c oxidase subunit II precursor; K0226... 48.1 7e-06 tgo:TGME49_110470 cytochrome c oxidase subunit II, putative (E... 45.4 5e-05 bbo:BBOV_IV010440 23.m05821; cytochrome c oxidase subunit 2 (E... 45.1 5e-05 pfa:PF14_0288 cytochrome c oxidase subunit II precursor, putat... 43.5 2e-04 > mmu:17709 COX2; cytochrome c oxidase subunit II (EC:1.9.3.1); K02261 cytochrome c oxidase subunit II [EC:1.9.3.1] Length=227 Score = 100 bits (250), Expect = 8e-22, Method: Compositional matrix adjust. Identities = 47/55 (85%), Positives = 53/55 (96%), Gaps = 0/55 (0%) Query 1 SYEYTDYEDLSFDSYIIPTSELKPGELRLLEVDNRVVLPIEITIRMLVSSEDVLH 55 SYEYTDYEDL FDSY+IPT++LKPGELRLLEVDNRVVLP+E+ IRML+SSEDVLH Sbjct 107 SYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLH 161 > xla:2642081 COX2; cytochrome c oxidase subunit II; K02261 cytochrome c oxidase subunit II [EC:1.9.3.1] Length=229 Score = 87.8 bits (216), Expect = 7e-18, Method: Compositional matrix adjust. Identities = 39/55 (70%), Positives = 50/55 (90%), Gaps = 0/55 (0%) Query 1 SYEYTDYEDLSFDSYIIPTSELKPGELRLLEVDNRVVLPIEITIRMLVSSEDVLH 55 SYEYT+YEDLSFDSY+IPT++L PG+ RLLEVDNR+V+P+E R+LV++EDVLH Sbjct 107 SYEYTNYEDLSFDSYMIPTNDLTPGQFRLLEVDNRMVVPMESPTRLLVTAEDVLH 161 > dre:140540 COX2, mtco2; cytochrome c oxidase subunit II; K02261 cytochrome c oxidase subunit II [EC:1.9.3.1] Length=230 Score = 80.9 bits (198), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 37/55 (67%), Positives = 46/55 (83%), Gaps = 0/55 (0%) Query 1 SYEYTDYEDLSFDSYIIPTSELKPGELRLLEVDNRVVLPIEITIRMLVSSEDVLH 55 SYEYTDYE+L FDSY++PT +L PG RLLE D+R+V+P E IR+LVS+EDVLH Sbjct 107 SYEYTDYENLEFDSYMVPTQDLTPGGFRLLETDHRMVVPKESPIRILVSAEDVLH 161 > hsa:4513 COX2, COII, MTCO2; cytochrome c oxidase subunit II; K02261 cytochrome c oxidase subunit II [EC:1.9.3.1] Length=227 Score = 79.7 bits (195), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 36/55 (65%), Positives = 47/55 (85%), Gaps = 0/55 (0%) Query 1 SYEYTDYEDLSFDSYIIPTSELKPGELRLLEVDNRVVLPIEITIRMLVSSEDVLH 55 +YEYTDY L F+SY++P L+PG+LRLL+VDNRVVLPIE IRM+++S+DVLH Sbjct 107 TYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLH 161 > ath:ArthMp015 cox2; cytochrome c oxidase subunit 2; K02261 cytochrome c oxidase subunit II [EC:1.9.3.1] Length=260 Score = 63.2 bits (152), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 31/60 (51%), Positives = 45/60 (75%), Gaps = 5/60 (8%) Query 1 SYEYTDY-----EDLSFDSYIIPTSELKPGELRLLEVDNRVVLPIEITIRMLVSSEDVLH 55 +YEY+DY + L+FDSY+IP +L+ G+ RLLEVDNRVV+P + +R++V+S DV H Sbjct 128 TYEYSDYNSSDEQSLTFDSYMIPEEDLELGQSRLLEVDNRVVVPAKTHLRIIVTSADVPH 187 > cel:COX2 cytochrome c oxidase subunit II; K02261 cytochrome c oxidase subunit II [EC:1.9.3.1] Length=231 Score = 62.4 bits (150), Expect = 3e-10, Method: Composition-based stats. Identities = 29/55 (52%), Positives = 37/55 (67%), Gaps = 0/55 (0%) Query 1 SYEYTDYEDLSFDSYIIPTSELKPGELRLLEVDNRVVLPIEITIRMLVSSEDVLH 55 SYEY+D L FDSY+ +L GE RLLEVDNR V+P + IR ++S DV+H Sbjct 110 SYEYSDIPGLEFDSYMKSLDQLSLGEPRLLEVDNRCVIPCDTNIRFCITSADVIH 164 > sce:Q0250 COX2, OXI1, OXII; Cox2p (EC:1.9.3.1); K02261 cytochrome c oxidase subunit II [EC:1.9.3.1] Length=251 Score = 53.1 bits (126), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 25/60 (41%), Positives = 41/60 (68%), Gaps = 5/60 (8%) Query 1 SYEYTDY-----EDLSFDSYIIPTSELKPGELRLLEVDNRVVLPIEITIRMLVSSEDVLH 55 YEY+D+ E + F+SY+IP L+ G+LRLL+ D +V+P++ IR +V++ DV+H Sbjct 127 KYEYSDFINDSGETVEFESYVIPDELLEEGQLRLLDTDTSMVVPVDTHIRFVVTAADVIH 186 > tpv:TP01_0683 cytochrome c oxidase subunit II precursor; K02261 cytochrome c oxidase subunit II [EC:1.9.3.1] Length=176 Score = 48.1 bits (113), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 23/45 (51%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 11 SFDSYIIPTSELKPGELRLLEVDNRVVLPIEITIRMLVSSEDVLH 55 SF S ++ +L+PG LR LEVD R+ LP IR LV++ DVLH Sbjct 64 SFQSNLVTDEDLQPGMLRQLEVDKRLTLPTRTHIRFLVTATDVLH 108 > tgo:TGME49_110470 cytochrome c oxidase subunit II, putative (EC:1.9.3.1); K02261 cytochrome c oxidase subunit II [EC:1.9.3.1] Length=191 Score = 45.4 bits (106), Expect = 5e-05, Method: Composition-based stats. Identities = 20/44 (45%), Positives = 28/44 (63%), Gaps = 0/44 (0%) Query 12 FDSYIIPTSELKPGELRLLEVDNRVVLPIEITIRMLVSSEDVLH 55 F S ++ +L PG LR LEVD R+ LP IR L+++ DV+H Sbjct 80 FQSNMVTDEDLLPGMLRNLEVDKRLTLPTRTHIRFLITATDVIH 123 > bbo:BBOV_IV010440 23.m05821; cytochrome c oxidase subunit 2 (EC:1.9.3.1); K02261 cytochrome c oxidase subunit II [EC:1.9.3.1] Length=168 Score = 45.1 bits (105), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 29/45 (64%), Gaps = 0/45 (0%) Query 11 SFDSYIIPTSELKPGELRLLEVDNRVVLPIEITIRMLVSSEDVLH 55 SF S ++ +L PG LR LEVD R+ LP IR L+++ DV+H Sbjct 55 SFQSNLVTDEDLVPGMLRQLEVDKRLTLPTRTHIRFLITATDVIH 99 > pfa:PF14_0288 cytochrome c oxidase subunit II precursor, putative; K02261 cytochrome c oxidase subunit II [EC:1.9.3.1] Length=172 Score = 43.5 bits (101), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 20/44 (45%), Positives = 28/44 (63%), Gaps = 0/44 (0%) Query 12 FDSYIIPTSELKPGELRLLEVDNRVVLPIEITIRMLVSSEDVLH 55 F S ++ +L+PG LR LEVD R+ LP I LV++ DV+H Sbjct 61 FQSNMVTDEDLQPGMLRQLEVDKRLTLPTRTHISFLVTATDVIH 104 Lambda K H 0.317 0.139 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2009826104 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40