bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_0717_orf1 Length=118 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_039720 ribosomal protein L24, putative ; K02895 lar... 127 6e-30 pfa:PFL1150c mitochondrial ribosomal protein L24-2 precursor, ... 108 5e-24 bbo:BBOV_III010490 17.m07907; ribosomal protein L24; K02895 la... 84.7 6e-17 tpv:TP02_0094 60S ribosomal protein L24; K02895 large subunit ... 67.0 1e-11 pfa:PFF0245w mitochondrial ribosomal protein L24 precursor, pu... 41.6 7e-04 dre:436674 mrpl24, zgc:92702; mitochondrial ribosomal protein L24 40.8 0.001 xla:394416 mrpl24, L24, rpl24, rpl24-A; mitochondrial ribosoma... 39.7 0.002 ath:AT5G23535 KOW domain-containing protein 39.3 0.003 tgo:TGME49_016010 50S ribosomal protein L24, putative 36.6 0.018 mmu:67707 Mrpl24, 2010005E08Rik, 2810470K06Rik, 6720473G22Rik,... 34.7 0.073 bbo:BBOV_II007320 18.m06608; 50S ribosomal subunit L24 34.7 0.074 tpv:TP02_0188 60S ribosomal protein L24 34.3 0.11 hsa:79590 MRPL24, FLJ20917, L24mt, MGC22737, MGC9831, MRP-L18,... 33.5 0.17 dre:795805 NLR family, CARD domain containing 30.8 1.1 sce:YGR215W RSM27; Mitochondrial ribosomal protein of the smal... 28.9 4.3 dre:100333916 myomegalin-like 28.1 6.4 tpv:TP04_0879 mannose-6-phosphate isomerase (EC:5.3.1.8); K018... 28.1 7.4 dre:568999 si:dkey-71c4.3; K08853 AP2-associated kinase [EC:2.... 27.7 8.2 tgo:TGME49_118260 hypothetical protein 27.7 9.3 > tgo:TGME49_039720 ribosomal protein L24, putative ; K02895 large subunit ribosomal protein L24 Length=229 Score = 127 bits (320), Expect = 6e-30, Method: Compositional matrix adjust. Identities = 61/89 (68%), Positives = 77/89 (86%), Gaps = 1/89 (1%) Query 8 LPIHLTNLALLDPIVKRPTRVKRRYMMNGEVVRIFKLSGCAMPEPL-TPLPRPPSLYQQF 66 +PIH+TN+ALLDP+VKRPTRVKRR+MMNGE VRI KLSG AMPEP+ T R P+LYQ++ Sbjct 112 MPIHITNVALLDPVVKRPTRVKRRFMMNGECVRISKLSGSAMPEPVSTSALRQPNLYQEY 171 Query 67 LREKAKGPPIKEKYANPDPLHMQLLKQLA 95 LR+KA GPP+K YA PDPLH+++L++LA Sbjct 172 LRQKALGPPLKASYARPDPLHLKILQRLA 200 > pfa:PFL1150c mitochondrial ribosomal protein L24-2 precursor, putative Length=227 Score = 108 bits (269), Expect = 5e-24, Method: Compositional matrix adjust. Identities = 50/90 (55%), Positives = 69/90 (76%), Gaps = 1/90 (1%) Query 8 LPIHLTNLALLDPIVKRPTRVKRRYMMNGEVVRIFKLSGCAMPEPL-TPLPRPPSLYQQF 66 +PIH+TN++LLDPI K+PT VKRRYMMNGE VRI K+SGCAMPEP+ + + + Y++F Sbjct 113 MPIHITNVSLLDPISKKPTVVKRRYMMNGECVRISKISGCAMPEPVHKNILKEQNNYERF 172 Query 67 LREKAKGPPIKEKYANPDPLHMQLLKQLAF 96 + +K GPPIK+ YA D + LLK++A+ Sbjct 173 MHKKKIGPPIKDIYAEKDYKNFNLLKKIAY 202 > bbo:BBOV_III010490 17.m07907; ribosomal protein L24; K02895 large subunit ribosomal protein L24 Length=218 Score = 84.7 bits (208), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 44/91 (48%), Positives = 61/91 (67%), Gaps = 12/91 (13%) Query 8 LPIHLTNLALLDPIVKRPTRVKRRYMMNGEVVRIFKLSGCAMPEPLT---PLPRPPSLYQ 64 +PIH++N+AL+DP+VK+PT VKRRYMMNGE VRI KLSGCA+P+P+ L +PP Sbjct 115 MPIHISNVALVDPVVKKPTIVKRRYMMNGECVRICKLSGCALPKPVEVVKGLYKPPP--- 171 Query 65 QFLREKAKGPPIKEKYANPDPLHMQLLKQLA 95 + PIK+ YA+ D + +L +A Sbjct 172 ------KRTVPIKDDYAHKDYDNFNMLVNIA 196 > tpv:TP02_0094 60S ribosomal protein L24; K02895 large subunit ribosomal protein L24 Length=154 Score = 67.0 bits (162), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 28/39 (71%), Positives = 36/39 (92%), Gaps = 0/39 (0%) Query 8 LPIHLTNLALLDPIVKRPTRVKRRYMMNGEVVRIFKLSG 46 +PIH+TN++L+DP++K+PT VKRRYMMNGE VRI KLSG Sbjct 114 MPIHVTNISLVDPVMKKPTIVKRRYMMNGECVRICKLSG 152 > pfa:PFF0245w mitochondrial ribosomal protein L24 precursor, putative Length=194 Score = 41.6 bits (96), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 0/43 (0%) Query 10 IHLTNLALLDPIVKRPTRVKRRYMMNGEVVRIFKLSGCAMPEP 52 IH +N+ L+D +K T+V RY + +V+RI K SG +P P Sbjct 99 IHYSNVQLIDNFLKTNTKVALRYTDDNQVIRISKKSGTVIPWP 141 > dre:436674 mrpl24, zgc:92702; mitochondrial ribosomal protein L24 Length=216 Score = 40.8 bits (94), Expect = 0.001, Method: Compositional matrix adjust. Identities = 17/45 (37%), Positives = 30/45 (66%), Gaps = 0/45 (0%) Query 9 PIHLTNLALLDPIVKRPTRVKRRYMMNGEVVRIFKLSGCAMPEPL 53 P+ L ++AL+DP ++PT ++ RY GE VR+ +G +P+P+ Sbjct 114 PLLLKDIALIDPTDRKPTEIQWRYTEEGERVRVSVRTGRIIPKPV 158 > xla:394416 mrpl24, L24, rpl24, rpl24-A; mitochondrial ribosomal protein L24 Length=276 Score = 39.7 bits (91), Expect = 0.002, Method: Compositional matrix adjust. Identities = 17/45 (37%), Positives = 29/45 (64%), Gaps = 0/45 (0%) Query 9 PIHLTNLALLDPIVKRPTRVKRRYMMNGEVVRIFKLSGCAMPEPL 53 P+ L ++L+DP ++PT ++ RY GE VR+ SG +P+P+ Sbjct 114 PLLLNQVSLIDPTDRKPTEIEWRYTEEGERVRVSARSGRIIPKPV 158 > ath:AT5G23535 KOW domain-containing protein Length=159 Score = 39.3 bits (90), Expect = 0.003, Method: Compositional matrix adjust. Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 7/60 (11%) Query 9 PIHLTNLALLDPIVKRPTRVKRRYMMNGEVVRIFK---LSGCAMPEP----LTPLPRPPS 61 P+H +N+ ++DP+ RP +V +Y+ +G VR+ + SG +P P + PRP + Sbjct 73 PLHASNVQVVDPVTGRPCKVGVKYLEDGTKVRVARGTGTSGSIIPRPEILKIRATPRPTT 132 > tgo:TGME49_016010 50S ribosomal protein L24, putative Length=438 Score = 36.6 bits (83), Expect = 0.018, Method: Composition-based stats. Identities = 20/43 (46%), Positives = 26/43 (60%), Gaps = 0/43 (0%) Query 10 IHLTNLALLDPIVKRPTRVKRRYMMNGEVVRIFKLSGCAMPEP 52 IH++N+ L+D + PTRV R G VVRI K SG +P P Sbjct 319 IHVSNVMLIDQAIDLPTRVALRVDDRGNVVRISKKSGLVIPWP 361 > mmu:67707 Mrpl24, 2010005E08Rik, 2810470K06Rik, 6720473G22Rik, AA407670, MGC25749, MGC38056, MGC7749; mitochondrial ribosomal protein L24 Length=216 Score = 34.7 bits (78), Expect = 0.073, Method: Compositional matrix adjust. Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 0/41 (0%) Query 15 LALLDPIVKRPTRVKRRYMMNGEVVRIFKLSGCAMPEPLTP 55 + L+DP+ ++PT ++ R+ GE VR+ SG +P+P P Sbjct 120 VKLVDPVDRKPTEIQWRFTEAGERVRVSTRSGRIIPKPEFP 160 > bbo:BBOV_II007320 18.m06608; 50S ribosomal subunit L24 Length=200 Score = 34.7 bits (78), Expect = 0.074, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 0/41 (0%) Query 10 IHLTNLALLDPIVKRPTRVKRRYMMNGEVVRIFKLSGCAMP 50 IH +N+ L+DP++ TRV R+ + E +R+ K SG +P Sbjct 144 IHYSNVQLIDPLLNCATRVAIRFNKDNEPLRVSKKSGYVIP 184 > tpv:TP02_0188 60S ribosomal protein L24 Length=233 Score = 34.3 bits (77), Expect = 0.11, Method: Compositional matrix adjust. Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 0/43 (0%) Query 10 IHLTNLALLDPIVKRPTRVKRRYMMNGEVVRIFKLSGCAMPEP 52 IH +N+ L+D ++ TRV RY + + +R+ K SG +P P Sbjct 150 IHYSNVQLVDQLLNVGTRVSIRYSHDNKPLRVSKKSGYVIPWP 192 > hsa:79590 MRPL24, FLJ20917, L24mt, MGC22737, MGC9831, MRP-L18, MRP-L24; mitochondrial ribosomal protein L24 Length=216 Score = 33.5 bits (75), Expect = 0.17, Method: Compositional matrix adjust. Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 0/42 (0%) Query 14 NLALLDPIVKRPTRVKRRYMMNGEVVRIFKLSGCAMPEPLTP 55 + L+DP+ ++PT ++ R+ GE VR+ SG +P+P P Sbjct 119 QVKLVDPMDRKPTEIEWRFTEAGERVRVSTRSGRIIPKPEFP 160 > dre:795805 NLR family, CARD domain containing Length=1033 Score = 30.8 bits (68), Expect = 1.1, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Query 19 DPIVKRPTRVKRRYMMNGEVVRIFKLSGCAMPEPLTPLPRPPSLYQQFLREKAKGP 74 DP+ P R+KR+ + + E+ + SG +M +P+ P + Q RE+ + P Sbjct 29 DPVTSDP-RIKRQRLESSEISDVSVKSGRSMEQPMRFSDAPVTSNPQMRRERLESP 83 > sce:YGR215W RSM27; Mitochondrial ribosomal protein of the small subunit Length=110 Score = 28.9 bits (63), Expect = 4.3, Method: Compositional matrix adjust. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 0/31 (0%) Query 64 QQFLREKAKGPPIKEKYANPDPLHMQLLKQL 94 + L E+ KGP + Y NPD L + LK L Sbjct 32 SKILNERLKGPSVASYYGNPDILKFRHLKTL 62 > dre:100333916 myomegalin-like Length=636 Score = 28.1 bits (61), Expect = 6.4, Method: Composition-based stats. Identities = 10/36 (27%), Positives = 19/36 (52%), Gaps = 0/36 (0%) Query 43 KLSGCAMPEPLTPLPRPPSLYQQFLREKAKGPPIKE 78 +L C+ P P +P P +Q L + + PP+++ Sbjct 340 QLEQCSEPRPSPTIPASPLYRRQLLHDPSPSPPVRD 375 > tpv:TP04_0879 mannose-6-phosphate isomerase (EC:5.3.1.8); K01809 mannose-6-phosphate isomerase [EC:5.3.1.8] Length=454 Score = 28.1 bits (61), Expect = 7.4, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 0/50 (0%) Query 34 MNGEVVRIFKLSGCAMPEPLTPLPRPPSLYQQFLREKAKGPPIKEKYANP 83 ++G+ V I K S + LT PR L L E K P K+ Y P Sbjct 289 VSGDCVEIMKCSDNVIRCGLTSKPRDAKLCISLLEENLKNPSAKDFYVTP 338 > dre:568999 si:dkey-71c4.3; K08853 AP2-associated kinase [EC:2.7.11.1] Length=802 Score = 27.7 bits (60), Expect = 8.2, Method: Composition-based stats. Identities = 23/66 (34%), Positives = 28/66 (42%), Gaps = 11/66 (16%) Query 53 LTPLPRP---PSLYQQFLREKAKGPPIKEKYANPD-----PLHMQLLKQ---LAFFFLNK 101 LTP RP P Q A PP+ ++ A P P H QL Q AFF + Sbjct 385 LTPRKRPSAPPGPSQPISVNMASQPPVAQQQATPSPPQTTPQHAQLFVQQQNTAFFTAQQ 444 Query 102 QPAAAA 107 Q AA + Sbjct 445 QSAAGS 450 > tgo:TGME49_118260 hypothetical protein Length=959 Score = 27.7 bits (60), Expect = 9.3, Method: Compositional matrix adjust. Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 7/50 (14%) Query 27 RVKRRYMMNGEVVRIFKLSGCAMPEPLTPLPRPPS----LYQQFLREKAK 72 R KR ++ GE +R +L A P L PLP PP LY++ ++++ + Sbjct 319 RTKRVRLLGGENLRETEL---AEPNSLLPLPEPPKDSFLLYRRLIKQQTE 365 Lambda K H 0.322 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2027872200 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40