bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_0882_orf2 Length=101 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_014590 microfibrillar-associated protein 1, putativ... 112 3e-25 bbo:BBOV_II002390 18.m06195; micro-fibrillar-associated protei... 74.7 7e-14 dre:393992 mfap1, MGC56551, zgc:56551; microfibrillar-associat... 72.0 4e-13 hsa:4236 MFAP1; microfibrillar-associated protein 1; K13110 mi... 72.0 5e-13 mmu:67532 Mfap1a, 4432409M24Rik, Mfap1; microfibrillar-associa... 71.6 5e-13 mmu:100034361 Mfap1b; microfibrillar-associated protein 1B; K1... 71.6 5e-13 pfa:MAL13P1.132 microfibril-associated protein homologue, puta... 71.2 7e-13 xla:379834 mfap1, MGC53463; microfibrillar-associated protein 1 71.2 xla:735061 hypothetical protein MGC85054; K13110 microfibrilla... 70.9 1e-12 ath:AT4G08580 hypothetical protein 67.8 9e-12 ath:AT5G17900 hypothetical protein; K13110 microfibrillar-asso... 67.4 1e-11 tpv:TP04_0360 hypothetical protein; K13110 microfibrillar-asso... 67.0 2e-11 cel:F43G9.10 hypothetical protein; K13110 microfibrillar-assoc... 53.1 2e-07 ath:AT5G56660 ILL2; ILL2; IAA-Ala conjugate hydrolase/ IAA-ami... 28.5 4.8 > tgo:TGME49_014590 microfibrillar-associated protein 1, putative ; K13110 microfibrillar-associated protein 1 Length=438 Score = 112 bits (280), Expect = 3e-25, Method: Compositional matrix adjust. Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 2/98 (2%) Query 1 QDLARSGEEPLYLWDFNAPVGEDKVDKKTLPKILQLRRGELARGGRSKHTHLVDVDTSDL 60 QDLARSGEE LYL D+NAPVGEDK DKK LP +++RRGE R G++KHTHLVDVDT+D Sbjct 343 QDLARSGEEALYLRDYNAPVGEDKWDKKILPSAMRVRRGEFGRQGQTKHTHLVDVDTTDF 402 Query 61 SHPWAQATRDLQGQKLLKKAAGIKGANDFERPSLRKPK 98 + WA T+ +K K G KGA +F+RP+ R K Sbjct 403 TSAWAFNTK--IKEKTDSKMGGRKGAKEFDRPAARPKK 438 > bbo:BBOV_II002390 18.m06195; micro-fibrillar-associated protein 1 C-terminus containing protein; K13110 microfibrillar-associated protein 1 Length=437 Score = 74.7 bits (182), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 31/60 (51%), Positives = 41/60 (68%), Gaps = 0/60 (0%) Query 7 GEEPLYLWDFNAPVGEDKVDKKTLPKILQLRRGELARGGRSKHTHLVDVDTSDLSHPWAQ 66 G EP+Y DFNAP +D VDK +PK +Q+RRG+ + GRSK+THL DT+ PW+Q Sbjct 353 GSEPIYKRDFNAPTADDCVDKSLMPKSMQVRRGQYGKMGRSKYTHLTAEDTTKFDMPWSQ 412 > dre:393992 mfap1, MGC56551, zgc:56551; microfibrillar-associated protein 1; K13110 microfibrillar-associated protein 1 Length=437 Score = 72.0 bits (175), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 39/93 (41%), Positives = 57/93 (61%), Gaps = 7/93 (7%) Query 7 GEEPLYLWDFNAPVGEDKVDKKTLPKILQLRRGELARGGRSKHTHLVDVDTSDLSHPWAQ 66 GE+ ++ DF+AP ED +K LPK++Q++ R GR+K+THLVD DT+ WAQ Sbjct 350 GEQDVFKRDFSAPTLEDHFNKTILPKVMQVK--NFGRSGRTKYTHLVDQDTTSFDSAWAQ 407 Query 67 ATRDLQGQKLLKKAAGIKGAND-FERPSLRKPK 98 + Q K K+ AG G D F+RP+++K K Sbjct 408 ES--AQNSKFFKQKAG--GVRDVFDRPTVQKRK 436 > hsa:4236 MFAP1; microfibrillar-associated protein 1; K13110 microfibrillar-associated protein 1 Length=439 Score = 72.0 bits (175), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 40/91 (43%), Positives = 54/91 (59%), Gaps = 7/91 (7%) Query 9 EPLYLWDFNAPVGEDKVDKKTLPKILQLRRGELARGGRSKHTHLVDVDTSDLSHPWAQAT 68 E +Y DF+AP ED +K LPK++Q++ R GR+K+THLVD DT+ W Q + Sbjct 353 EEVYKRDFSAPTLEDHFNKTILPKVMQVK--NFGRSGRTKYTHLVDQDTTSFDSAWGQES 410 Query 69 RDLQGQKLLK-KAAGIKGANDFERPSLRKPK 98 Q K K KAAG++ FERPS +K K Sbjct 411 --AQNTKFFKQKAAGVRDV--FERPSAKKRK 437 > mmu:67532 Mfap1a, 4432409M24Rik, Mfap1; microfibrillar-associated protein 1A Length=439 Score = 71.6 bits (174), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 40/91 (43%), Positives = 54/91 (59%), Gaps = 7/91 (7%) Query 9 EPLYLWDFNAPVGEDKVDKKTLPKILQLRRGELARGGRSKHTHLVDVDTSDLSHPWAQAT 68 E +Y DF+AP ED +K LPK++Q++ R GR+K+THLVD DT+ W Q + Sbjct 353 EEVYKRDFSAPTLEDHFNKTILPKVMQVK--NFGRSGRTKYTHLVDQDTTSFDSAWGQES 410 Query 69 RDLQGQKLLK-KAAGIKGANDFERPSLRKPK 98 Q K K KAAG++ FERPS +K K Sbjct 411 --AQNTKFFKQKAAGVRDV--FERPSAKKRK 437 > mmu:100034361 Mfap1b; microfibrillar-associated protein 1B; K13110 microfibrillar-associated protein 1 Length=439 Score = 71.6 bits (174), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 40/91 (43%), Positives = 54/91 (59%), Gaps = 7/91 (7%) Query 9 EPLYLWDFNAPVGEDKVDKKTLPKILQLRRGELARGGRSKHTHLVDVDTSDLSHPWAQAT 68 E +Y DF+AP ED +K LPK++Q++ R GR+K+THLVD DT+ W Q + Sbjct 353 EEVYKRDFSAPTLEDHFNKTILPKVMQVK--NFGRSGRTKYTHLVDQDTTSFDSAWGQES 410 Query 69 RDLQGQKLLK-KAAGIKGANDFERPSLRKPK 98 Q K K KAAG++ FERPS +K K Sbjct 411 --AQNTKFFKQKAAGVRDV--FERPSAKKRK 437 > pfa:MAL13P1.132 microfibril-associated protein homologue, putative; K13110 microfibrillar-associated protein 1 Length=492 Score = 71.2 bits (173), Expect = 7e-13, Method: Composition-based stats. Identities = 35/64 (54%), Positives = 47/64 (73%), Gaps = 0/64 (0%) Query 1 QDLARSGEEPLYLWDFNAPVGEDKVDKKTLPKILQLRRGELARGGRSKHTHLVDVDTSDL 60 QDL G+E +YL D+N PV EDKVD++ LPK+LQ+RRG+ + G+SK+THL+D DTS Sbjct 403 QDLFEEGKEEIYLRDYNEPVYEDKVDRQNLPKVLQVRRGKFGKQGQSKYTHLLDNDTSRK 462 Query 61 SHPW 64 W Sbjct 463 DSLW 466 > xla:379834 mfap1, MGC53463; microfibrillar-associated protein 1 Length=441 Score = 71.2 bits (173), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 40/92 (43%), Positives = 56/92 (60%), Gaps = 7/92 (7%) Query 8 EEPLYLWDFNAPVGEDKVDKKTLPKILQLRRGELARGGRSKHTHLVDVDTSDLSHPWAQA 67 +E +Y DF+AP ED +K LPK++Q++ R GR+K+THLVD DT+ W Q Sbjct 354 DENVYKRDFSAPTLEDHFNKTILPKVMQVK--NFGRSGRTKYTHLVDQDTTSFDSAWGQD 411 Query 68 TRDLQGQKLLK-KAAGIKGANDFERPSLRKPK 98 + Q K K KAAG++ FERPS++K K Sbjct 412 --NPQNTKFFKQKAAGVRDV--FERPSVQKRK 439 > xla:735061 hypothetical protein MGC85054; K13110 microfibrillar-associated protein 1 Length=442 Score = 70.9 bits (172), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 40/91 (43%), Positives = 55/91 (60%), Gaps = 7/91 (7%) Query 9 EPLYLWDFNAPVGEDKVDKKTLPKILQLRRGELARGGRSKHTHLVDVDTSDLSHPWAQAT 68 E +Y DF+AP ED +K LPK++Q++ R GR+K+THLVD DT+ W Q Sbjct 356 ENVYKRDFSAPTLEDHFNKTILPKVMQVK--NFGRSGRTKYTHLVDQDTTSFDSAWGQD- 412 Query 69 RDLQGQKLLK-KAAGIKGANDFERPSLRKPK 98 + Q K K KAAG++ FERPS++K K Sbjct 413 -NPQNTKFFKQKAAGVRDV--FERPSVQKRK 440 > ath:AT4G08580 hypothetical protein Length=435 Score = 67.8 bits (164), Expect = 9e-12, Method: Compositional matrix adjust. Identities = 34/78 (43%), Positives = 52/78 (66%), Gaps = 4/78 (5%) Query 6 SGEEPLYLWDFNAPVGEDKVDKKTLPKILQLRRGELARGGRSKHTHLVDVDTSDLSHPWA 65 +G + ++ DF+AP GED++DK LPK++Q++ R GR+K THLV+ DT+D S+PW Sbjct 344 AGTDGIFQRDFSAPTGEDRLDKSILPKVMQVK--HFGRSGRTKWTHLVNEDTTDWSNPW- 400 Query 66 QATRDLQGQKLLKKAAGI 83 + D +K KK AG+ Sbjct 401 -TSNDPLREKYNKKMAGM 417 > ath:AT5G17900 hypothetical protein; K13110 microfibrillar-associated protein 1 Length=435 Score = 67.4 bits (163), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 34/78 (43%), Positives = 52/78 (66%), Gaps = 4/78 (5%) Query 6 SGEEPLYLWDFNAPVGEDKVDKKTLPKILQLRRGELARGGRSKHTHLVDVDTSDLSHPWA 65 +G + ++ DF+AP GED++DK LPK++Q++ R GR+K THLV+ DT+D S+PW Sbjct 344 AGTDGIFQRDFSAPTGEDRLDKSILPKVMQVK--HFGRSGRTKWTHLVNEDTTDWSNPW- 400 Query 66 QATRDLQGQKLLKKAAGI 83 + D +K KK AG+ Sbjct 401 -TSNDPLREKYNKKMAGM 417 > tpv:TP04_0360 hypothetical protein; K13110 microfibrillar-associated protein 1 Length=408 Score = 67.0 bits (162), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 39/88 (44%), Positives = 50/88 (56%), Gaps = 11/88 (12%) Query 9 EPLYLWDFNAPVGEDKVDKKTLPKILQLRRGELARGGRSKHTHLVDVDTSDLSHPWAQAT 68 EPLY DFNAP ED VDK LPK +++RRG + G+ KHTHL DVDT+ W++ Sbjct 332 EPLYARDFNAPTAEDCVDKSLLPKPMRVRRGLYGKQGQVKHTHLKDVDTTQFD-AWSKTD 390 Query 69 RDLQGQKLLKKAAGIKGANDFERPSLRK 96 + K G K F+RPS +K Sbjct 391 K--------YKLTGTKQV--FDRPSKKK 408 > cel:F43G9.10 hypothetical protein; K13110 microfibrillar-associated protein 1 Length=466 Score = 53.1 bits (126), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 30/84 (35%), Positives = 47/84 (55%), Gaps = 5/84 (5%) Query 15 DFNAPVGEDKVDKKTLPKILQLRRGELARGGRSKHTHLVDVDTSDLSHPWAQATRDLQGQ 74 +F +D+ DK LPK++Q++ + R+K+THL + DT+D WA +T L Q Sbjct 387 NFAEATNDDQFDKTILPKVMQVK--NFGKASRTKYTHLTEEDTTDHQGVWA-STNQLNSQ 443 Query 75 KLLKKAAGIKGANDFERPSLRKPK 98 K+A G + FERP+ +K K Sbjct 444 FSTKRAGGSRPV--FERPATKKRK 465 > ath:AT5G56660 ILL2; ILL2; IAA-Ala conjugate hydrolase/ IAA-amino acid conjugate hydrolase/ metallopeptidase; K14664 IAA-amino acid hydrolase [EC:3.5.1.-] Length=439 Score = 28.5 bits (62), Expect = 4.8, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 0/35 (0%) Query 55 VDTSDLSHPWAQATRDLQGQKLLKKAAGIKGANDF 89 V+ DL + + RDL GQ+ +AA + G+ DF Sbjct 336 VNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDF 370 Lambda K H 0.313 0.133 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2036602604 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40