bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_0921_orf1 Length=100 Score E Sequences producing significant alignments: (Bits) Value pfa:PF11_0395 guanylyl cyclase; K01769 guanylate cyclase, othe... 74.3 9e-14 tgo:TGME49_054370 adenylate and guanylate cyclase catalytic do... 57.8 8e-09 tpv:TP02_0848 guanylyl cyclase 51.6 7e-07 bbo:BBOV_I000770 16.m00775; adenylate and guanylate cyclase ca... 48.5 6e-06 cpv:cgd3_1110 P-type ATpase fused to two adenyl cyclase domain... 34.3 0.10 tgo:TGME49_088880 hypothetical protein 30.8 1.2 dre:560446 similar to TGF-beta type II receptor; K04388 TGF-be... 28.9 4.4 dre:553526 MGC152774, ZCWCC3; zgc:152774 28.5 5.1 hsa:2064 ERBB2, CD340, HER-2, HER-2/neu, HER2, MLN_19, NEU, NG... 28.1 6.4 > pfa:PF11_0395 guanylyl cyclase; K01769 guanylate cyclase, other [EC:4.6.1.2] Length=4226 Score = 74.3 bits (181), Expect = 9e-14, Method: Composition-based stats. Identities = 39/95 (41%), Positives = 58/95 (61%), Gaps = 6/95 (6%) Query 2 SWMGIRWLIFWLNILFIFAA----LAFVLTNARDPGKKAPSEWHTADTVELSFFLTLIHH 57 S + I+W+IF+LN+LFI AA +A++ + + + W T DT+E F+L ++HH Sbjct 3804 SLLNIKWMIFFLNLLFISAACVFSIAYLWAISETDQTTSYTIWMTNDTIEFFFYLVILHH 3863 Query 58 NTGLLFQHIIFVDALLITAS--FSSAMLVSQPTTE 90 NTG+LFQ I VD L IT S F + +V TT+ Sbjct 3864 NTGMLFQTCILVDLLFITMSLTFIATSVVKTITTD 3898 > tgo:TGME49_054370 adenylate and guanylate cyclase catalytic domain-containing protein (EC:4.6.1.1 3.6.3.1 1.15.1.1 4.6.1.2 3.1.3.48 2.8.3.8) Length=4368 Score = 57.8 bits (138), Expect = 8e-09, Method: Composition-based stats. Identities = 25/61 (40%), Positives = 40/61 (65%), Gaps = 0/61 (0%) Query 35 KAPSEWHTADTVELSFFLTLIHHNTGLLFQHIIFVDALLITASFSSAMLVSQPTTERLRG 94 +A + W +DT+EL F++ ++HHNTGLLFQ+ I VD LL+T S + + ++ T + Sbjct 3897 RAYTYWLLSDTIELFFYIVILHHNTGLLFQNCILVDVLLMTMSLTFIITTARETASTVST 3956 Query 95 I 95 I Sbjct 3957 I 3957 Score = 34.3 bits (77), Expect = 0.11, Method: Composition-based stats. Identities = 12/24 (50%), Positives = 19/24 (79%), Gaps = 0/24 (0%) Query 6 IRWLIFWLNILFIFAALAFVLTNA 29 +RW++F LN+LFI A+ F L+N+ Sbjct 3773 LRWMVFLLNLLFISASCVFALSNS 3796 > tpv:TP02_0848 guanylyl cyclase Length=2664 Score = 51.6 bits (122), Expect = 7e-07, Method: Composition-based stats. Identities = 23/66 (34%), Positives = 39/66 (59%), Gaps = 0/66 (0%) Query 14 NILFIFAALAFVLTNARDPGKKAPSEWHTADTVELSFFLTLIHHNTGLLFQHIIFVDALL 73 N LF L ++LT + + W +D+VE F+L L+HH+TG+LFQ+ + +D+L Sbjct 2311 NYLFQLTNLLYILTLCHNGCSVDYNLWLNSDSVEFYFYLILLHHSTGMLFQNCLLIDSLF 2370 Query 74 ITASFS 79 + S + Sbjct 2371 LVLSMT 2376 > bbo:BBOV_I000770 16.m00775; adenylate and guanylate cyclase catalytic domain containing protein Length=2446 Score = 48.5 bits (114), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 5/77 (6%) Query 8 WLIFWLNILFIFAALAFVLTNA-----RDPGKKAPSEWHTADTVELSFFLTLIHHNTGLL 62 WL F LN+ F+ AA F L+ + P + W +D + ++ +IHHN G+L Sbjct 2095 WLTFALNLFFVSAACVFSLSGSWAVEHNHPNFHLANIWLPSDNFKFYTYIVVIHHNNGML 2154 Query 63 FQHIIFVDALLITASFS 79 FQ + VD+L + S S Sbjct 2155 FQTCLLVDSLFMVISMS 2171 > cpv:cgd3_1110 P-type ATpase fused to two adenyl cyclase domains and 21 predicted transmembrane regions Length=3848 Score = 34.3 bits (77), Expect = 0.10, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 9/49 (18%) Query 55 IHHNTGLLFQHIIFVDAL---LITASFSSAMLVSQPTTERLRGILIVCL 100 +HHN GLLF++I+ D L LI FS + V+ L GI++ C+ Sbjct 3424 VHHNAGLLFKYIVLFDLLIMFLILTIFSVGINVN------LEGIVVYCV 3466 > tgo:TGME49_088880 hypothetical protein Length=599 Score = 30.8 bits (68), Expect = 1.2, Method: Composition-based stats. Identities = 21/85 (24%), Positives = 35/85 (41%), Gaps = 17/85 (20%) Query 22 LAFVLTNARDPGKKAPSEWH-----------------TADTVELSFFLTLIHHNTGLLFQ 64 L+ +L AR+PG K S H AD +E++ L+ +H +G Sbjct 420 LSLLLATAREPGGKCHSRLHFPRNSRGAAALSGLCLAVADEIEVNLALSWVHLLSGFARA 479 Query 65 HIIFVDALLITASFSSAMLVSQPTT 89 HI D + A S+ L ++ + Sbjct 480 HIAHADLFEVAALPLSSFLETKAAS 504 > dre:560446 similar to TGF-beta type II receptor; K04388 TGF-beta receptor type-2 [EC:2.7.11.30] Length=576 Score = 28.9 bits (63), Expect = 4.4, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Query 15 ILFIFAALAFVLTNARDPGKKAPSEW 40 ++ + A +AF L R PGKK P EW Sbjct 142 LVAVIATMAFYLYRTRQPGKK-PKEW 166 > dre:553526 MGC152774, ZCWCC3; zgc:152774 Length=306 Score = 28.5 bits (62), Expect = 5.1, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 0/43 (0%) Query 19 FAALAFVLTNARDPGKKAPSEWHTADTVELSFFLTLIHHNTGL 61 F+A+A ++ NA DPG A + W TV L+ + +G+ Sbjct 30 FSAVAELIDNASDPGVTAKNIWIDVVTVRDQLCLSFTDNGSGM 72 > hsa:2064 ERBB2, CD340, HER-2, HER-2/neu, HER2, MLN_19, NEU, NGL, TKR1; v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian) (EC:2.7.10.1); K05083 receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1] Length=1225 Score = 28.1 bits (61), Expect = 6.4, Method: Composition-based stats. Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 0/27 (0%) Query 47 ELSFFLTLIHHNTGLLFQHIIFVDALL 73 EL L LIHHNT L F H + D L Sbjct 430 ELGSGLALIHHNTHLCFVHTVPWDQLF 456 Lambda K H 0.332 0.141 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2041372988 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40