bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_0943_orf1 Length=140 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_080560 selenophosphate synthetase, putative (EC:2.7... 61.6 7e-10 mmu:107823 Whsc1, 5830445G22Rik, 9430010A17Rik, AW555663, C130... 30.8 1.5 dre:664772 MGC136804; zgc:136804 30.4 1.9 sce:YLR386W VAC14; Protein involved in regulated synthesis of ... 30.0 2.5 dre:100332783 toll-like receptor 19-like 29.6 2.7 dre:403134 tlr19; toll-like receptor 19 29.6 ath:AT2G35020 UTP--glucose-1-phosphate uridylyltransferase fam... 28.9 5.8 dre:564961 dnttip2, cb88, sb:cb1016, sb:cb88; deoxynucleotidyl... 28.5 6.3 tgo:TGME49_074070 thiF family domain-containing protein ; K045... 28.5 7.0 cpv:cgd1_1520 extracellular membrane associated protein with a... 28.1 7.9 mmu:21939 Cd40, AI326936, Bp50, GP39, HIGM1, IGM, IMD3, T-BAM,... 28.1 9.1 ath:AT1G31070 UDP-N-acetylglucosamine pyrophosphorylase-relate... 28.1 9.9 cel:F35G12.8 smc-4; SMC (structural maintenance of chromosomes... 28.1 9.9 > tgo:TGME49_080560 selenophosphate synthetase, putative (EC:2.7.9.3 1.8.1.4); K01008 selenide, water dikinase [EC:2.7.9.3] Length=1189 Score = 61.6 bits (148), Expect = 7e-10, Method: Compositional matrix adjust. Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 0/78 (0%) Query 63 PVSSVSLLLVTETTEVLYSAMVPGYITGEFNLPDLTVDLAPLCSFAGASLITARAVGLLP 122 P + L LV+ T+ Y ++PG + G + VDL LC AG + A +G+ Sbjct 41 PEKGMRLTLVSADTDTPYKGLLPGLLAGAYTRDQAHVDLLQLCQVAGGRFVRASVLGVDR 100 Query 123 QQKLLLLDGSRPPLRFDV 140 ++KL+ D RPPLR+DV Sbjct 101 ERKLIFCDDGRPPLRYDV 118 > mmu:107823 Whsc1, 5830445G22Rik, 9430010A17Rik, AW555663, C130020C13Rik, D030027O06Rik, D930023B08Rik, Whsc1l, mKIAA1090; Wolf-Hirschhorn syndrome candidate 1 (human) (EC:2.1.1.43); K11424 histone-lysine N-methyltransferase NSD1/2 [EC:2.1.1.43] Length=1366 Score = 30.8 bits (68), Expect = 1.5, Method: Composition-based stats. Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Query 5 LRKQRETTADKTTPCSS--AAGAASTDKTAAA 34 LRKQRET DKT SS A AAS+ K+ AA Sbjct 556 LRKQRETITDKTARTSSYKAIEAASSLKSQAA 587 > dre:664772 MGC136804; zgc:136804 Length=449 Score = 30.4 bits (67), Expect = 1.9, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 0/39 (0%) Query 52 CSNNSGCINNLPVSSVSLLLVTETTEVLYSAMVPGYITG 90 CS+ C+ P +SV L L E ++ A +PG ITG Sbjct 364 CSSQGRCVRRDPSASVYLHLNPEMWSIIPRAQLPGPITG 402 > sce:YLR386W VAC14; Protein involved in regulated synthesis of PtdIns(3,5)P(2), in control of trafficking of some proteins to the vacuole lumen via the MVB, and in maintenance of vacuole size and acidity; interacts with Fig4p; activator of Fab1p Length=880 Score = 30.0 bits (66), Expect = 2.5, Method: Composition-based stats. Identities = 26/70 (37%), Positives = 33/70 (47%), Gaps = 4/70 (5%) Query 56 SGCINNLPVSSVSLLLVTETTEVLYSAMVPGYITGEFNLPDLTVDLAPLCSFAGASLITA 115 S C N PVS +SL V E E+ Y+ + Y E L DL V L L + + T Sbjct 651 SWCPN--PVSVISLCFVAENYELAYTVL-QTYANYELKLNDL-VQLDILIQLFESPVFTR 706 Query 116 RAVGLLPQQK 125 + LL QQK Sbjct 707 MRLQLLEQQK 716 > dre:100332783 toll-like receptor 19-like Length=735 Score = 29.6 bits (65), Expect = 2.7, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 7/48 (14%) Query 93 NLPDLTVDLA-------PLCSFAGASLITARAVGLLPQQKLLLLDGSR 133 N+ DL+ DL+ LC F + I A+A LP ++L +DG R Sbjct 20 NITDLSTDLSQVGFEVRTLCVFGDITSIPAKAFSHLPSLEVLHIDGIR 67 > dre:403134 tlr19; toll-like receptor 19 Length=735 Score = 29.6 bits (65), Expect = 2.7, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 7/48 (14%) Query 93 NLPDLTVDLA-------PLCSFAGASLITARAVGLLPQQKLLLLDGSR 133 N+ DL+ DL+ LC F + I A+A LP ++L +DG R Sbjct 20 NITDLSTDLSQVGFEVRTLCVFGDITSIPAKAFSHLPSLEVLHIDGIR 67 > ath:AT2G35020 UTP--glucose-1-phosphate uridylyltransferase family protein (EC:2.7.7.23); K00972 UDP-N-acetylglucosamine pyrophosphorylase [EC:2.7.7.23] Length=502 Score = 28.9 bits (63), Expect = 5.8, Method: Compositional matrix adjust. Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Query 53 SNNSGCINNLPVSSVSLLLVTETTEVLYSAMVPGYITGEFNLPDLTVDLAPLCSFAGASL 112 N +G + P S+ L+L T V+ + G++T L V+++PLCS+AG +L Sbjct 429 KNANGSNYDTPESARLLVLRLHTRWVIAAG---GFLTHSVPLYATGVEVSPLCSYAGENL 485 > dre:564961 dnttip2, cb88, sb:cb1016, sb:cb88; deoxynucleotidyltransferase, terminal, interacting protein 2 Length=941 Score = 28.5 bits (62), Expect = 6.3, Method: Compositional matrix adjust. Identities = 20/73 (27%), Positives = 31/73 (42%), Gaps = 5/73 (6%) Query 17 TPCSSAAGAASTDKTAAAVLRSILGKDAAVAADEECSNNSGCINNL-----PVSSVSLLL 71 TPCSS G+AS+++ A K A EE S + + + P + + Sbjct 320 TPCSSRTGSASSNRAVPASRTRSKAKVITSAMSEEQSEDEQLVTHHEGIQAPEEQLDQTM 379 Query 72 VTETTEVLYSAMV 84 ET+E S M+ Sbjct 380 TMETSEAQESTMI 392 > tgo:TGME49_074070 thiF family domain-containing protein ; K04532 amyloid beta precursor protein binding protein 1 Length=779 Score = 28.5 bits (62), Expect = 7.0, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 5/44 (11%) Query 91 EFNLPDLTVD---LAPLCSFAGASLITARAV--GLLPQQKLLLL 129 E N+PDLTVD + + +F GA + T A+ G+ Q+ + L+ Sbjct 711 EINVPDLTVDERIIRQMVAFGGAEIHTTAAIVGGVAAQEAVKLI 754 > cpv:cgd1_1520 extracellular membrane associated protein with a signal peptide, EGF domain, 9x transmembrane domains and a pentraxin domain Length=3008 Score = 28.1 bits (61), Expect = 7.9, Method: Composition-based stats. Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 4/67 (5%) Query 36 LRSILGKDAAVAADEECSNNSGCINNLPVSSVSLLLVTETTEVLYSAMVPGYITGEFNLP 95 LR L + + E N+G I N+ ++ L+ +T + Y+ +PGYI E+N P Sbjct 1029 LRLKLNRGTGLLFSEPNLENNG-IENMELNHS--LINEDTKDKKYNVPIPGYIEEEYNEP 1085 Query 96 -DLTVDL 101 L VDL Sbjct 1086 RSLDVDL 1092 > mmu:21939 Cd40, AI326936, Bp50, GP39, HIGM1, IGM, IMD3, T-BAM, TRAP, Tnfrsf5, p50; CD40 antigen; K03160 tumor necrosis factor receptor superfamily member 5 Length=289 Score = 28.1 bits (61), Expect = 9.1, Method: Compositional matrix adjust. Identities = 22/91 (24%), Positives = 37/91 (40%), Gaps = 21/91 (23%) Query 4 GLRKQRETTADKTTPCSSAAGAASTDKTAAAVLRSILGKDAAVAADEECSNNSGCINNLP 63 GLR ++E TA+ T C+ G T K A C+ ++ CI Sbjct 88 GLRVKKEGTAESDTVCTCKEGQHCTSKDCEA-----------------CAQHTPCIPGFG 130 Query 64 VSSVSLLLVTETTEVLYSAMVPGYITGEFNL 94 V + + TETT+ + G+ + + +L Sbjct 131 V----MEMATETTDTVCHPCPVGFFSNQSSL 157 > ath:AT1G31070 UDP-N-acetylglucosamine pyrophosphorylase-related (EC:2.7.7.23); K00972 UDP-N-acetylglucosamine pyrophosphorylase [EC:2.7.7.23] Length=505 Score = 28.1 bits (61), Expect = 9.9, Method: Compositional matrix adjust. Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Query 53 SNNSGCINNLPVSSVSLLLVTETTEVLYSAMVPGYITGEFNLPDLTVDLAPLCSFAGASL 112 N +G + P S+ L+L T V+ + G++T L V+++PLCS+AG +L Sbjct 432 KNVNGSNFDTPESARLLVLRLHTRWVIAAG---GFLTHSVPLYATGVEVSPLCSYAGENL 488 > cel:F35G12.8 smc-4; SMC (structural maintenance of chromosomes) family member (smc-4); K06675 structural maintenance of chromosome 4 Length=1549 Score = 28.1 bits (61), Expect = 9.9, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 6 RKQRETTADKTTPCSSAAGAASTDK 30 RK R AD+TTP S + +AST K Sbjct 1499 RKARNIEADETTPPSKRSNSASTPK 1523 Lambda K H 0.316 0.131 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2552834388 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40