bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_1025_orf1 Length=61 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_002680 mitochondrial-processing peptidase alpha sub... 74.7 6e-14 xla:734517 pmpca, MGC114896; peptidase (mitochondrial processi... 44.7 7e-05 dre:492801 pmpca, wu:fi19e06, wu:fj83d11, zgc:101647; peptidas... 43.9 1e-04 mmu:66865 Pmpca, 1200002L24Rik, 4933435E07Rik, Alpha-MPP, P-55... 42.4 4e-04 hsa:23203 PMPCA, Alpha-MPP, FLJ26258, INPP5E, KIAA0123, MGC104... 40.4 0.001 pfa:PFE1155c mitochondrial processing peptidase alpha subunit,... 38.5 0.005 ath:AT3G16480 MPPalpha (mitochondrial processing peptidase alp... 33.1 0.24 cel:Y71G12B.24 mppa-1; Mitochondrial Processing Peptidase Alph... 31.6 0.71 xla:496289 hypothetical LOC496289; K01412 mitochondrial proces... 31.2 0.76 xla:432215 pmpcb, MGC78954; peptidase (mitochondrial processin... 30.8 1.2 bbo:BBOV_III003850 17.m07356; mitochondrial processing peptida... 30.4 1.5 xla:379401 uqcrc1, MGC53748; ubiquinol-cytochrome c reductase ... 29.6 2.2 > tgo:TGME49_002680 mitochondrial-processing peptidase alpha subunit, putative (EC:3.4.24.64); K01412 mitochondrial processing peptidase [EC:3.4.24.64] Length=563 Score = 74.7 bits (182), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%) Query 20 DIRRVAEKMFSKPPTVVAYGDICSVPHYEEIRAALRAAGVGK 61 DI+RV + M+ KPPTVVAYGD+ +VPHYEE+RAALRAAGVGK Sbjct 522 DIKRVVDAMYKKPPTVVAYGDVSTVPHYEEVRAALRAAGVGK 563 Score = 31.6 bits (70), Expect = 0.73, Method: Compositional matrix adjust. Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 0/20 (0%) Query 1 MLHQTAWHNNTLWLKLFATD 20 +LH TAWHNNTL KL T+ Sbjct 269 LLHTTAWHNNTLGHKLHCTE 288 > xla:734517 pmpca, MGC114896; peptidase (mitochondrial processing) alpha (EC:3.4.24.64); K01412 mitochondrial processing peptidase [EC:3.4.24.64] Length=518 Score = 44.7 bits (104), Expect = 7e-05, Method: Compositional matrix adjust. Identities = 20/39 (51%), Positives = 26/39 (66%), Gaps = 0/39 (0%) Query 18 ATDIRRVAEKMFSKPPTVVAYGDICSVPHYEEIRAALRA 56 A+DI+RVA KM P V A GD+ +P YE I+AAL + Sbjct 467 ASDIKRVATKMLRNKPAVAALGDLTELPDYEHIQAALSS 505 > dre:492801 pmpca, wu:fi19e06, wu:fj83d11, zgc:101647; peptidase (mitochondrial processing) alpha (EC:3.4.24.64); K01412 mitochondrial processing peptidase [EC:3.4.24.64] Length=517 Score = 43.9 bits (102), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 19/39 (48%), Positives = 26/39 (66%), Gaps = 0/39 (0%) Query 18 ATDIRRVAEKMFSKPPTVVAYGDICSVPHYEEIRAALRA 56 A+DI+RV KM P V A GD+ +P YE+I+AAL + Sbjct 466 ASDIKRVTMKMLRSKPAVAALGDLTELPSYEDIQAALSS 504 > mmu:66865 Pmpca, 1200002L24Rik, 4933435E07Rik, Alpha-MPP, P-55; peptidase (mitochondrial processing) alpha (EC:3.4.24.64); K01412 mitochondrial processing peptidase [EC:3.4.24.64] Length=524 Score = 42.4 bits (98), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 21/46 (45%), Positives = 27/46 (58%), Gaps = 0/46 (0%) Query 11 TLWLKLFATDIRRVAEKMFSKPPTVVAYGDICSVPHYEEIRAALRA 56 TL + DI+RVA KM P V A GD+ +P YE I+AAL + Sbjct 466 TLIRNVKPEDIKRVASKMLRGKPAVAALGDLTDLPTYEHIQAALSS 511 > hsa:23203 PMPCA, Alpha-MPP, FLJ26258, INPP5E, KIAA0123, MGC104197; peptidase (mitochondrial processing) alpha (EC:3.4.24.64); K01412 mitochondrial processing peptidase [EC:3.4.24.64] Length=525 Score = 40.4 bits (93), Expect = 0.001, Method: Compositional matrix adjust. Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 0/46 (0%) Query 11 TLWLKLFATDIRRVAEKMFSKPPTVVAYGDICSVPHYEEIRAALRA 56 TL + D++RVA KM P V A GD+ +P YE I+ AL + Sbjct 467 TLIRNVKPEDVKRVASKMLRGKPAVAALGDLTDLPTYEHIQTALSS 512 > pfa:PFE1155c mitochondrial processing peptidase alpha subunit, putative; K01412 mitochondrial processing peptidase [EC:3.4.24.64] Length=534 Score = 38.5 bits (88), Expect = 0.005, Method: Composition-based stats. Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 0/31 (0%) Query 20 DIRRVAEKMFSKPPTVVAYGDICSVPHYEEI 50 DI+RV PTVV YG+I PHY+EI Sbjct 497 DIQRVVHNFLKTKPTVVVYGNINYSPHYDEI 527 Score = 29.6 bits (65), Expect = 2.8, Method: Composition-based stats. Identities = 11/17 (64%), Positives = 14/17 (82%), Gaps = 0/17 (0%) Query 1 MLHQTAWHNNTLWLKLF 17 +LH TAW+NNTL KL+ Sbjct 243 LLHNTAWYNNTLGNKLY 259 > ath:AT3G16480 MPPalpha (mitochondrial processing peptidase alpha subunit); catalytic/ metal ion binding / metalloendopeptidase/ zinc ion binding; K01412 mitochondrial processing peptidase [EC:3.4.24.64] Length=499 Score = 33.1 bits (74), Expect = 0.24, Method: Compositional matrix adjust. Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 0/41 (0%) Query 15 KLFATDIRRVAEKMFSKPPTVVAYGDICSVPHYEEIRAALR 55 +L DI K+ +KP T+ +GD+ +VP Y+ + R Sbjct 459 QLTLKDIADFTSKVITKPLTMATFGDVLNVPSYDSVSKRFR 499 > cel:Y71G12B.24 mppa-1; Mitochondrial Processing Peptidase Alpha family member (mppa-1); K01412 mitochondrial processing peptidase [EC:3.4.24.64] Length=477 Score = 31.6 bits (70), Expect = 0.71, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 0/27 (0%) Query 15 KLFATDIRRVAEKMFSKPPTVVAYGDI 41 K+ +DI RV E++ + P++V YGDI Sbjct 428 KVTNSDIIRVTERLLASKPSLVGYGDI 454 > xla:496289 hypothetical LOC496289; K01412 mitochondrial processing peptidase [EC:3.4.24.64] Length=479 Score = 31.2 bits (69), Expect = 0.76, Method: Compositional matrix adjust. Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Query 18 ATDIRRVAEK-MFSKPPTVVAYGDICSVPHYEEIRAAL 54 A IR V K +++K P V A G I +P+Y+ IR+ + Sbjct 437 AETIREVCTKYIYNKSPAVAAVGPIGELPNYDRIRSGM 474 > xla:432215 pmpcb, MGC78954; peptidase (mitochondrial processing) beta (EC:3.4.24.64); K01412 mitochondrial processing peptidase [EC:3.4.24.64] Length=479 Score = 30.8 bits (68), Expect = 1.2, Method: Compositional matrix adjust. Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query 18 ATDIRRVAEK-MFSKPPTVVAYGDICSVPHYEEIRAAL 54 A IR V K +++K P V A G I +P Y+ IR+ + Sbjct 437 AETIREVCTKYIYNKSPAVAAVGPIGQLPDYDRIRSGM 474 > bbo:BBOV_III003850 17.m07356; mitochondrial processing peptidase alpha subunit; K01412 mitochondrial processing peptidase [EC:3.4.24.64] Length=496 Score = 30.4 bits (67), Expect = 1.5, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query 18 ATDIRRVAEKMFS-KPPTVVAYGDICSVPHYEEI 50 A DI+R + M P+VVA G++ +PH EE+ Sbjct 457 ALDIQRCVQSMLKGSKPSVVALGNLAFMPHPEEL 490 Score = 28.5 bits (62), Expect = 5.3, Method: Composition-based stats. Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 0/20 (0%) Query 1 MLHQTAWHNNTLWLKLFATD 20 +LH AWHNNTL L + ++ Sbjct 206 LLHSVAWHNNTLGLPNYCSE 225 > xla:379401 uqcrc1, MGC53748; ubiquinol-cytochrome c reductase core protein I (EC:1.10.2.2); K00414 ubiquinol-cytochrome c reductase core subunit 1 [EC:1.10.2.2] Length=478 Score = 29.6 bits (65), Expect = 2.2, Method: Compositional matrix adjust. Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query 12 LWLKLFATDIRRVAE----KMFSKPPTVVAYGDICSVPHYEEIRAAL 54 L ++ A D ++V+E ++ K P V G I +P Y IR+A+ Sbjct 427 LNARIDAVDAKKVSEICSKYLYDKCPAVAGVGPIEQIPDYNRIRSAM 473 Lambda K H 0.323 0.134 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2064920148 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40