bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_1173_orf1 Length=78 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_023620 golgi SNARE protein, putative 73.2 2e-13 cpv:cgd1_2920 golgi transport SNARE BOS1 secretory pathway pro... 63.5 1e-10 ath:AT5G50440 MEMB12; MEMB12 (MEMBRIN 12); SNAP receptor; K084... 54.7 6e-08 xla:380410 gosr2, MGC64459; golgi SNAP receptor complex member... 48.9 4e-06 dre:324569 gosr2, wu:fc33b02, zgc:64068; golgi SNAP receptor c... 47.8 9e-06 xla:446602 MGC81773 protein; K08496 golgi SNAP receptor comple... 46.6 2e-05 mmu:56494 Gosr2, 2310032N09Rik, C76855, Gs27, SNARE, membrin; ... 45.8 3e-05 cel:B0272.2 gosr-2.1; GOlgi Snap Receptor complex member famil... 45.4 5e-05 ath:AT2G36900 MEMB11; MEMB11 (MEMBRIN 11); SNAP receptor; K084... 44.3 1e-04 pfa:PF11_0119 GS27; SNARE protein, putative 41.2 8e-04 sce:YHL031C GOS1; Gos1p; K08495 golgi SNAP receptor complex me... 33.5 0.19 ath:AT1G15880 GOS11; GOS11 (golgi snare 11); SNARE binding; K0... 32.0 0.48 eco:b0036 caiD, ECK0037, JW0035, yaaL; carnitinyl-CoA dehydrat... 29.3 2.9 cel:F20B6.3 mrp-6; Multidrug Resistance Protein family member ... 27.7 8.8 > tgo:TGME49_023620 golgi SNARE protein, putative Length=264 Score = 73.2 bits (178), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 34/69 (49%), Positives = 56/69 (81%), Gaps = 0/69 (0%) Query 2 DSRTVLDSVLSQGWGIVGQLVSQNASLKNARRKVLDMASSAGVASTLLGAVGRRQQGDKW 61 +S ++LD++LSQG + ++V QN+ LK+A+RK+LDM +S+G+A++LLGA+ RR+ D+ Sbjct 165 ESHSMLDAILSQGRSALDKVVQQNSVLKSAKRKILDMNTSSGLAASLLGAISRREATDRR 224 Query 62 LVYGGMVVT 70 LV+GGM +T Sbjct 225 LVWGGMFLT 233 > cpv:cgd1_2920 golgi transport SNARE BOS1 secretory pathway protein, possible transmembrane or GPI anchor at C-terminus ; K08496 golgi SNAP receptor complex member 2 Length=220 Score = 63.5 bits (153), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 31/75 (41%), Positives = 45/75 (60%), Gaps = 0/75 (0%) Query 1 QDSRTVLDSVLSQGWGIVGQLVSQNASLKNARRKVLDMASSAGVASTLLGAVGRRQQGDK 60 Q+S +D L Q IV L +QN LK+ R+K LDMAS G++ +LL + RR D+ Sbjct 134 QESHIAIDHALEQARSIVFNLKNQNRMLKSVRKKALDMASRLGISHSLLSNIERRNLVDQ 193 Query 61 WLVYGGMVVTLIFFF 75 LVYG +++T + F Sbjct 194 ILVYGCILLTSLIFI 208 > ath:AT5G50440 MEMB12; MEMB12 (MEMBRIN 12); SNAP receptor; K08496 golgi SNAP receptor complex member 2 Length=219 Score = 54.7 bits (130), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 23/75 (30%), Positives = 46/75 (61%), Gaps = 0/75 (0%) Query 1 QDSRTVLDSVLSQGWGIVGQLVSQNASLKNARRKVLDMASSAGVASTLLGAVGRRQQGDK 60 ++S+ +L+ G I+ + Q LK+A+RK LD+ ++ G+++++L + RR + D Sbjct 138 KNSKRMLEDSFQSGVAILSKYAEQRDRLKSAQRKALDVLNTVGLSNSVLRLIERRNRVDT 197 Query 61 WLVYGGMVVTLIFFF 75 W+ Y GM+ TL+ + Sbjct 198 WIKYAGMIATLVILY 212 > xla:380410 gosr2, MGC64459; golgi SNAP receptor complex member 2; K08496 golgi SNAP receptor complex member 2 Length=210 Score = 48.9 bits (115), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 23/69 (33%), Positives = 43/69 (62%), Gaps = 0/69 (0%) Query 7 LDSVLSQGWGIVGQLVSQNASLKNARRKVLDMASSAGVASTLLGAVGRRQQGDKWLVYGG 66 +D +L G I+ L Q +LK A +K+LD+A+ G+++T++ + +R DK ++ GG Sbjct 135 IDDLLGSGSSILEGLRDQRKTLKGAHKKILDVANMLGLSNTVMRLIEKRAFQDKVIMIGG 194 Query 67 MVVTLIFFF 75 M++T +F Sbjct 195 MLLTCVFMI 203 > dre:324569 gosr2, wu:fc33b02, zgc:64068; golgi SNAP receptor complex member 2; K08496 golgi SNAP receptor complex member 2 Length=212 Score = 47.8 bits (112), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 45/75 (60%), Gaps = 0/75 (0%) Query 1 QDSRTVLDSVLSQGWGIVGQLVSQNASLKNARRKVLDMASSAGVASTLLGAVGRRQQGDK 60 Q++ +D +L G I+ L Q ++LK +K+LD+A+ G+++T++ + +R DK Sbjct 131 QNAHRGMDDLLGSGSSILNGLRDQRSTLKGTHKKMLDVANMLGLSNTVMRLIEKRASQDK 190 Query 61 WLVYGGMVVTLIFFF 75 +++ GM+ T + F Sbjct 191 FIMMAGMLATCVVMF 205 > xla:446602 MGC81773 protein; K08496 golgi SNAP receptor complex member 2 Length=194 Score = 46.6 bits (109), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 21/69 (30%), Positives = 42/69 (60%), Gaps = 0/69 (0%) Query 7 LDSVLSQGWGIVGQLVSQNASLKNARRKVLDMASSAGVASTLLGAVGRRQQGDKWLVYGG 66 +D +L G ++ L Q +LK +K+LD+A+ G+++T++ + +R DK ++ GG Sbjct 119 IDDLLGSGSSVLEGLRDQRKTLKGTHKKILDVANMLGLSNTVMRLIEKRAFQDKAIMIGG 178 Query 67 MVVTLIFFF 75 M++T +F Sbjct 179 MLLTCVFMI 187 > mmu:56494 Gosr2, 2310032N09Rik, C76855, Gs27, SNARE, membrin; golgi SNAP receptor complex member 2; K08496 golgi SNAP receptor complex member 2 Length=212 Score = 45.8 bits (107), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 21/69 (30%), Positives = 43/69 (62%), Gaps = 0/69 (0%) Query 7 LDSVLSQGWGIVGQLVSQNASLKNARRKVLDMASSAGVASTLLGAVGRRQQGDKWLVYGG 66 +D ++ G I+ L +Q +LK ++K+LD+A+ G+++T++ + +R DK+ + GG Sbjct 137 MDDLIGGGHSILEGLRAQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGG 196 Query 67 MVVTLIFFF 75 M++T F Sbjct 197 MLLTCAVMF 205 > cel:B0272.2 gosr-2.1; GOlgi Snap Receptor complex member family member (gosr-2.1); K08496 golgi SNAP receptor complex member 2 Length=213 Score = 45.4 bits (106), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 0/75 (0%) Query 1 QDSRTVLDSVLSQGWGIVGQLVSQNASLKNARRKVLDMASSAGVASTLLGAVGRRQQGDK 60 Q S T LD ++SQG ++ L SQ+ +L+ RK+ ++ + G++++ L + RR + D Sbjct 131 QSSHTHLDDLISQGSAVLENLKSQHLNLRGVGRKMHEIGQALGLSNSTLQVIDRRVREDW 190 Query 61 WLVYGGMVVTLIFFF 75 L G +V IF + Sbjct 191 ILFVIGCIVCCIFMY 205 > ath:AT2G36900 MEMB11; MEMB11 (MEMBRIN 11); SNAP receptor; K08496 golgi SNAP receptor complex member 2 Length=225 Score = 44.3 bits (103), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 20/65 (30%), Positives = 40/65 (61%), Gaps = 0/65 (0%) Query 1 QDSRTVLDSVLSQGWGIVGQLVSQNASLKNARRKVLDMASSAGVASTLLGAVGRRQQGDK 60 ++S+ +L+ S G I+ + Q LK+A+RK LD+ ++ G+++++L + RR + D Sbjct 144 KNSKRMLEESFSSGVAILSKYAEQRDRLKSAQRKALDVLNTVGLSNSVLRLIERRNRVDT 203 Query 61 WLVYG 65 W+ Y Sbjct 204 WIKYA 208 > pfa:PF11_0119 GS27; SNARE protein, putative Length=289 Score = 41.2 bits (95), Expect = 8e-04, Method: Composition-based stats. Identities = 22/63 (34%), Positives = 40/63 (63%), Gaps = 0/63 (0%) Query 13 QGWGIVGQLVSQNASLKNARRKVLDMASSAGVASTLLGAVGRRQQGDKWLVYGGMVVTLI 72 QG + L QN LKN R+KV+DM + G++S+L+ + + + + +V G++++LI Sbjct 219 QGMNTLNMLRKQNKFLKNVRKKVIDMYNYVGLSSSLVDTIKKAHKQNLIIVIVGIILSLI 278 Query 73 FFF 75 FF+ Sbjct 279 FFY 281 > sce:YHL031C GOS1; Gos1p; K08495 golgi SNAP receptor complex member 1 Length=223 Score = 33.5 bits (75), Expect = 0.19, Method: Compositional matrix adjust. Identities = 18/73 (24%), Positives = 34/73 (46%), Gaps = 0/73 (0%) Query 3 SRTVLDSVLSQGWGIVGQLVSQNASLKNARRKVLDMASSAGVASTLLGAVGRRQQGDKWL 62 S V+D ++SQ W Q SQ+ L A KVL + L+ + R++ + ++ Sbjct 148 SNNVVDRLISQAWETRSQFHSQSNVLNTANNKVLQTLQRIPGVNQLIMKINTRRKKNAFV 207 Query 63 VYGGMVVTLIFFF 75 + + ++F F Sbjct 208 LATITTLCILFLF 220 > ath:AT1G15880 GOS11; GOS11 (golgi snare 11); SNARE binding; K08495 golgi SNAP receptor complex member 1 Length=223 Score = 32.0 bits (71), Expect = 0.48, Method: Compositional matrix adjust. Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 2/71 (2%) Query 7 LDSVLSQGWGIVGQLVSQNASLKNARRKVLDMASSAGVASTLLGAVGRRQQGDKWL--VY 64 +D V+SQ +G LV Q ++ K+ ++AS +T+L A+ R++ D + + Sbjct 149 MDGVISQAQATLGTLVFQRSTFGGINSKLSNVASRLPTVNTILAAIKRKKSMDTIILSLV 208 Query 65 GGMVVTLIFFF 75 + LIF + Sbjct 209 AAVCTFLIFIY 219 > eco:b0036 caiD, ECK0037, JW0035, yaaL; carnitinyl-CoA dehydratase (EC:4.2.1.-); K08299 carnitinyl-CoA dehydratase [EC:4.2.1.-] Length=261 Score = 29.3 bits (64), Expect = 2.9, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 0/40 (0%) Query 15 WGIVGQLVSQNASLKNARRKVLDMASSAGVASTLLGAVGR 54 WGIV ++VSQ + NAR + +SA +A L + R Sbjct 173 WGIVNRVVSQAELMDNARELAQQLVNSAPLAIAALKEIYR 212 > cel:F20B6.3 mrp-6; Multidrug Resistance Protein family member (mrp-6); K02021 putative ABC transport system ATP-binding protein Length=1396 Score = 27.7 bits (60), Expect = 8.8, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 24/57 (42%), Gaps = 0/57 (0%) Query 7 LDSVLSQGWGIVGQLVSQNASLKNARRKVLDMASSAGVASTLLGAVGRRQQGDKWLV 63 LD L W G++ +N S+ KVL S + +G VGR G L+ Sbjct 1122 LDKQLLNSWPTKGEIEFENVSVNYGETKVLKNLSFVVLGGQKIGVVGRTGAGKSTLI 1178 Lambda K H 0.321 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2067704464 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40